Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1004 IGR994 IGR995 IGR996 IGR993 IGR1003 IGR992 IGR1000 IGR998 IGR1002 IGR997 IGR999 IGR1001 cspD, - HD1366 HD1361 HD1359 HD1362 HD1367 HD1369 pad, - HD1360 HD1371 cah, - HD1365 HD1370 HD1364 HD1357 pyrF, - HD1356 tgt, - HD1368 pmbA, - HD1363 cspD, - HD1366 HD1361 HD1359 HD1362 HD1367 HD1369 pad, - HD1360 HD1371 cah, - HD1365 HD1370 HD1364 HD1357 pyrF, - HD1356 tgt, - HD1368 pmbA, - HD1363 cspD, - HD1366 HD1359 HD1362 HD1367 HD1369 pad, - HD1360 HD1371 cah, - HD1365 HD1370 HD1361 HD1364 HD1357 pyrF, - HD1356 tgt, - HD1368 pmbA, - HD1363
* Calculated from Protein Sequence

Gene ID: HD1365

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
cah  

Definition:
carbonic anhydrase (carbonate dehydratase)

Gene Start:
1115086

Gene Stop:
1114403

Gene Length:
684

Molecular Weight*:
25595

pI*:
6.80

Net Charge*:
-0.88

EC:
4.2.1.1  

Functional Class:
Central intermediary metabolism; Other  

Pathway: pathway table
Nitrogen metabolism

Secondary Evidence:
Mitsuhashi,S. and Miyachi,S.
Amino acid sequence homology between N- and C-terminal halves of a
carbonic anhydrase in Porphyridium purpureum, as deduced from the
cloned cDNA
J. Biol. Chem. 271 (45), 28703-28709 (1996)
Medline: 97067104

Sung,Y.-C. and Fuchs,J.A.
Characterization of the cyn operon in Escherichia coli K12
J. Biol. Chem. 263, 14769-14775 (1988)
Medline: 89008347


Comment:


Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to hypothetical protein from H. influenzae (1175500) and E. coli (2506260), to carbonic anhydrase from Dictyostelium discoideum (1513236),Porphyridium purpureum (1395170), among others, and to cyanate permease homolog from E. coli (628673). HD1365 is 76% similar to residues 1-223 from YADF_HAEIN, hypothetical protein of H. influenzae. HD1365 is 59% similar to residues 55-266 from gb|AAB06760.1, carbonic anhydrase from D. discoideum. HD1365 is 65% similar to residues 1-179 from pir||S45203, cyanate permease homolog from E. coli.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0288
COG name: Carbonic anhydrase
Functional Class: P
The phylogenetic pattern of COG0288 is --t-y--CEBRhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001765 (Prokaryotic-type carbonic anhydrase) with a combined E-value of 8.3e-61.
    IPB001765A    28-71
    IPB001765B    76-100
    IPB001765C    116-128
    IPB001765D    157-192


ProDom Summary:  Protein Domain Search
Residues 33-99 are 92% similar to a (CARBONIC ANHYDRASE LYASE PROTEOME) protein domain (PD331464) which is seen in Q9CN64_PASMU.

Residues 101-187 are 78% similar to a (CARBONIC ANHYDRASE LYASE COMPLETE) protein domain (PD369772) which is seen in YADF_HAEIN.



Paralogs:  Local Blast Search
HD1365 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 30 to 193 (E-value = 6e-73) place HD1365 in the Pro_CA family which is described as Carbonic anhydrase (PF00484)

PDB Hit:
pdb|1DDZ|A Chain A, X-Ray Structure Of A Beta-Carbonic Anhydras... 201 5e-053
pdb|1EKJ|A Chain A, The X-Ray Crystallographic Structure Of Bet... 67 2e-012

Gene Protein Sequence:
MKQIEQLFINNHAWATRMKDEQSDYFKQLAEHQKPTYLWIGCSDSRVPAE
KLTGLGPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLNIEHIIICGHTN
CGGIKAAIGTVEDYGLISNWLLHIRDLWFKHSHLLGKLSPEQRANMMTRL
NVAEQVYNLGRCSIVKSAWECGKKLSIHGWVYDVNDGVLNDQGVIATSRE
NLEITYRNAIAKLTTEADELVAKKLAE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACAAATCGAACAATTGTTTATAAATAATCACGCTTGGGCAACACG
AATGAAAGATGAACAATCTGATTATTTTAAACAACTGGCAGAACATCAAA
AACCCACTTACTTATGGATCGGTTGTTCAGATAGTCGTGTACCCGCTGAA
AAACTGACCGGTTTAGGCCCTGGGGAGTTATTTGTACACCGTAACGTTGC
TAATTTAGTGATTCATACAGATCTAAACTGCCTATCCGTAGTGCAATACG
CGGTCGATGTATTAAATATTGAACATATTATTATTTGTGGCCATACAAAT
TGTGGCGGTATTAAAGCAGCAATTGGTACTGTTGAAGATTATGGACTCAT
TAGCAACTGGTTGCTGCATATTCGCGATTTATGGTTTAAACATAGCCATT
TGCTTGGCAAACTCTCACCCGAACAACGCGCCAATATGATGACGCGGTTA
AATGTCGCAGAACAAGTTTATAATCTTGGCCGTTGTTCAATTGTTAAATC
AGCGTGGGAATGCGGTAAAAAACTATCAATTCACGGCTGGGTTTATGATG
TTAATGACGGAGTGCTAAATGATCAAGGCGTAATTGCAACAAGTCGTGAG
AATCTAGAAATTACTTATCGTAATGCTATAGCCAAATTAACCACAGAGGC
TGACGAGTTAGTAGCAAAAAAATTAGCCGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy