Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR994 IGR995 IGR991 IGR996 IGR993 IGR990 IGR992 IGR989 IGR1000 IGR998 IGR997 IGR988 IGR999 cspD, - HD1366 HD1361 HD1359 HD1362 HD1367 pad, - HD1360 cah, - HD1365 HD1364 himD,ihfB, - HD1353 HD1354 HD1357 pyrF, - HD1356 HD1355 pmbA, - HD1363 rpS1,rpsA, - HD1352 cspD, - HD1366 HD1361 HD1359 HD1362 HD1367 pad, - HD1360 cah, - HD1365 HD1364 himD,ihfB, - HD1353 HD1354 HD1357 pyrF, - HD1356 HD1355 pmbA, - HD1363 rpS1,rpsA, - HD1352 HD1359 HD1362 HD1367 pad, - HD1360 cah, - HD1365 cspD, - HD1366 HD1361 HD1364 HD1354 HD1357 pyrF, - HD1356 HD1355 pmbA, - HD1363 rpS1,rpsA, - HD1352 himD,ihfB, - HD1353
* Calculated from Protein Sequence

Gene ID: HD1359

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1111177

Gene Stop:
1110737

Gene Length:
441

Molecular Weight*:
17114

pI*:
9.20

Net Charge*:
4.10

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 8-143 are 41% similar to 22124631 hypothetical protein [Yersinia pestis KIM]. Otherwise, two significant hits using gapped BLAST to hypothetical protein from E. coli (1176176) and Campylobacter jejuni (6968877), among others. HD1359 is 33% similar to residues 7-140 from YHBP_ECOLI.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 8-138 are 32% similar to a (PROTEOME COMPLETE PM1958 F147) protein domain (PD089234) which is seen in YHBP_ECOLI.



Paralogs:  Local Blast Search
HD1359 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MQKIPSFISRFIQDNHVVNFAAYTIDDFWTASCFYAFDHNMARLILLTSK
NTRHSQIMLHNPKIVGTISAQITDIQAIKGIQFSATSQLLTKQDTEYHSS
LTHYYQRHPFARLTSSDVWLLHLDMIKYTSNEYLFAQKSIWQRHTE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAAAATACCATCATTCATCAGTCGTTTTATTCAAGATAACCACGT
CGTCAATTTTGCAGCATACACTATTGATGATTTCTGGACAGCCAGTTGTT
TTTATGCATTTGATCACAACATGGCGCGTTTGATTTTACTGACCAGTAAA
AACACACGCCATTCACAAATTATGTTACATAACCCCAAAATAGTTGGCAC
CATCTCAGCACAAATAACAGATATTCAAGCAATTAAAGGTATTCAATTTT
CAGCCACATCTCAACTGCTGACCAAGCAAGATACTGAATACCATTCATCA
TTAACACACTACTATCAACGCCATCCATTTGCCCGCTTAACATCCAGTGA
TGTTTGGCTATTACATTTAGATATGATTAAATACACCTCAAATGAATACC
TATTTGCACAAAAGTCAATTTGGCAACGCCACACTGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy