Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR994 IGR987 IGR995 IGR991 IGR996 IGR993 IGR990 IGR992 IGR989 IGR998 IGR997 IGR988 HD1361 HD1359 HD1362 pad, - HD1360 cah, - HD1365 HD1364 himD,ihfB, - HD1353 HD1354 HD1357 cmk, - HD1351 pyrF, - HD1356 degS, - HD1350 HD1355 pmbA, - HD1363 rpS1,rpsA, - HD1352 HD1361 HD1359 HD1362 pad, - HD1360 cah, - HD1365 HD1364 himD,ihfB, - HD1353 HD1354 HD1357 cmk, - HD1351 pyrF, - HD1356 degS, - HD1350 HD1355 pmbA, - HD1363 rpS1,rpsA, - HD1352 HD1359 HD1362 pad, - HD1360 cah, - HD1365 HD1361 HD1364 HD1354 HD1357 cmk, - HD1351 pyrF, - HD1356 degS, - HD1350 HD1355 pmbA, - HD1363 rpS1,rpsA, - HD1352 himD,ihfB, - HD1353
* Calculated from Protein Sequence

Gene ID: HD1356

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pyrF  

Definition:
orotidine 5`-phosphate decarboxylase; OMP

Gene Start:
1109618

Gene Stop:
1110310

Gene Length:
693

Molecular Weight*:
25262

pI*:
5.40

Net Charge*:
-5.69

EC:
4.1.1.23  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Strych,U., Wohlfarth,S. and Winkler,U.K.
Orotidine-5"-monophosphate decarboxylase from Pseudomonas
aeruginosa PAO1: cloning, overexpression, and enzyme
characterization
Curr. Microbiol. 29 (6), 353-359 (1994)
MEDLINE: 95072489

Yaoi T, Laksanalamai P, Jiemjit A, Kagawa HK, Alton T, Trent JD.
Cloning and characterization of ftsZ and pyrF from the archaeon Thermoplasma acidophilum.
Biochem Biophys Res Commun. 2000 Sep 7;275(3):936-45.
PMID: 10973825

Arraiano CM, Cruz AA, Kushner SR.
Analysis of the in vivo decay of the Escherichia coli dicistronic pyrF-orfF transcript: evidence for multiple degradation pathways.
J Mol Biol. 1997 May 2;268(2):261-72.
PMID: 9159469


Comment:
0

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to orotidine 5`-phosphate decarboxylase from H. influenzae (1169245), E. coli (118361), Salmonella typhimurium (118367), Pseudomonas aeruginosa (2499356), among others. HD1356 is 82% similar to residues 1-229 from DCOP_HAEIN.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0284
COG name: Orotidine-5'-phosphate decarboxylase
Functional Class:  F
The phylogenetic pattern of COG0284 is amtkyqvceb-huj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001754 (Orotidine 5'-phosphate decarboxylase) with a combined E-value of 3.4e-06.
    IPB001754A    1-41
    IPB001754B    51-66
    IPB001754C    137-176
    IPB001754E    202-212


ProDom Summary:  Protein Domain Search
Residues 104-219 are 44% similar to a (DECARBOXYLASE BIOSYNTHESIS 5'-PHOSPHATE) protein domain (PD004586) which is seen in DCOP_BACCL.

Residues 6-225 are 83% similar to a (DECARBOXYLASE OROTIDINE OMP 5'-PHOSPHATE) protein domain (PD277339) which is seen in DCOP_HAEIN.

Residues 7-229 are 61% similar to a (DECARBOXYLASE LYASE SYNTHASE PYRIMIDINE BIOSYNTHESIS) protein domain (PD001042) which is seen in DCOP_SALTY.



Paralogs:  Local Blast Search

HD1356 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 225 (E-value = 7.3e-86) place HD1356 in the OMPdecase family which is described as Orotidine 5'-phosphate decarboxylase / HUMPS family (PF00215)

PDB Hit:
pdb|1EIX|C Chain C, Structure Of Orotidine 5'-Monophosphate Dec... 288 4e-079
pdb|1DBT|A Chain A, Crystal Structure Of Orotidine 5'-Monophosp... 160 1e-040

Gene Protein Sequence:
MDNKIIVALDYETENEALNFIDQVDPSLCRLKVGKEMFTTLGAHFVKQLH
DRKFDVFLDLKYHDIPNTVARAVRSAADLGVWMVDLHASGGLTMMEEAKK
ILEPYGKDAPLLIAVTVLTSMEDLDLLQIGINASPMEQVIRLSHLAKRAG
LDGVVCSPQEVEVLRTHCGDDFKLVTPGIRPAGSDFGDQRRVMTPKQAIQ
TGADFLVIGRPITQAQEPLSILKAINASIA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGACAATAAAATTATTGTTGCCTTAGATTATGAAACTGAAAATGAAGC
ATTGAATTTTATAGATCAGGTTGATCCGTCACTTTGTCGCTTGAAAGTGG
GTAAAGAAATGTTTACAACGTTAGGTGCTCACTTTGTTAAACAGCTTCAC
GACAGAAAATTTGATGTTTTTCTTGATTTAAAATATCACGATATTCCAAA
TACTGTGGCAAGGGCTGTGCGTTCAGCCGCTGATTTAGGGGTATGGATGG
TTGATTTACATGCGTCAGGTGGATTAACAATGATGGAGGAAGCAAAAAAA
ATTCTTGAGCCTTATGGTAAGGATGCGCCTTTATTAATTGCGGTGACGGT
ATTAACAAGTATGGAAGATTTAGATTTGTTACAAATTGGTATTAATGCTT
CTCCGATGGAACAGGTGATTCGGTTATCCCACCTTGCAAAACGTGCGGGA
CTAGATGGTGTAGTCTGTTCTCCACAAGAGGTAGAAGTGTTAAGAACGCA
TTGTGGTGATGATTTTAAACTTGTGACACCGGGTATTCGTCCAGCCGGTT
CAGATTTTGGTGATCAACGTCGTGTAATGACACCCAAACAGGCTATTCAA
ACGGGGGCTGATTTTTTAGTTATTGGTCGTCCTATTACTCAAGCACAAGA
ACCTTTATCCATTTTAAAAGCCATTAATGCTTCAATTGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy