Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR983 IGR987 IGR991 IGR985 IGR990 IGR992 IGR989 IGR986 IGR988 IGR982 IGR984 himD,ihfB, - HD1353 HD1354 HD1357 HD1349 HD1348 narQ, - HD1346 cmk, - HD1351 pyrF, - HD1356 HD1344 narQ, - HD1345 degS, - HD1350 HD1355 rpS1,rpsA, - HD1352 himD,ihfB, - HD1353 HD1354 HD1357 HD1349 HD1348 narQ, - HD1346 cmk, - HD1351 pyrF, - HD1356 HD1344 narQ, - HD1345 degS, - HD1350 HD1355 rpS1,rpsA, - HD1352 HD1354 HD1348 narQ, - HD1346 cmk, - HD1351 pyrF, - HD1356 HD1344 narQ, - HD1345 degS, - HD1350 HD1355 rpS1,rpsA, - HD1352 himD,ihfB, - HD1353 HD1357 HD1349
* Calculated from Protein Sequence

Gene ID: HD1351

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
cmk  

Definition:
cytidylate kinase

Gene Start:
1105256

Gene Stop:
1105930

Gene Length:
675

Molecular Weight*:
24338

pI*:
7.70

Net Charge*:
0.49

EC:
2.7.4.14  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Fricke,J., Neuhard,J., Kelln,R.A. and Pedersen,S.
The cmk gene encoding cytidine monophosphate kinase is located in
the rpsA operon and is required for normal replication rate in
Escherichia coli
J. Bacteriol. 177 (3), 517-523 (1995)
MEDLINE: 95138007

Schultz,C.P., Ylisastigui-Pons,L., Serina,L., Sakamoto,H.,
Mantsch,H.H., Neuhard,J., Barzu,O. and Gilles,A.M.
Structural and catalytic properties of CMP kinase from Bacillus
subtilis: a comparative analysis with the homologous enzyme from
Escherichia coli
Arch. Biochem. Biophys. 340 (1), 144-153 (1997)
MEDLINE: 97271336


Comment:
0

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to cytidylate kinase from H. influenzae (1170627), E. coli (2506790),Bordetella bronchiseptica (6013216) among others. HD1351 is 64% similar to residues 2-217 from KCY1_HAEIN.

HD1351 is similar to cytidylate kinase from C. pneumoniae (CPn0568), C. trachomatis (CT452), M. pneumoniae (MP0365), M. genitalium (MG330), U. urealyticum (UU342), and T. pallidum (TP0279).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0283
COG name: Cytidylate kinase
Functional Class:  F
The phylogenetic pattern of COG0283 is -----qvcebrH--gpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003136 (Cytidylate kinase) with a combined E-value of 6.6e-81.
    IPB003136A    6-39
    IPB003136B    84-118
    IPB003136C    127-164
    IPB003136D    172-203


ProDom Summary:  Protein Domain Search
Residues 65-218 are 67% similar to a (KINASE CYTIDYLATE ATP-BINDING CYTIDINE) protein domain (PD005731) which is seen in KCY_PASMU.

Residues 5-39 are 85% similar to a (KINASE CYTIDYLATE ATP-BINDING CYTIDINE) protein domain (PD034497) which is seen in KCY_PASMU.



Paralogs:  Local Blast Search

HD1351 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 59 to 216 (E-value = 4e-68) place HD1351 in the Cytidylate_kin family which is described as Cytidylate kinase (PF02224)

PDB Hit:
pdb|2CMK|A Chain A, Cytidine Monophosphate Kinase In Complex Wi... 244 8e-066
pdb|1CKE|A Chain A, Cmp Kinase From Escherichia Coli Free Enzym... 241 5e-065

Gene Protein Sequence:
MNNFVITVDGPSGVGKGTLSAALANKLGFALLDSGAIYRISALAALRQGI
AFDDEDELAKLIPTLAIEFISNNDEVTAILNGENVTTQIRSAEAGQNASK
IAIFPKVRAALLQRQRDFSSPMGLIADGRDMGTIVFPDAQVKFFLEASAE
ERTKRRVKQLQEKGFNANFGEILAEIKTRDLRDRTRAVVPLVPAKDALLL
DSTHLSIEEVISQALAHIAKFKKF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAATTTTGTCATTACGGTAGATGGTCCAAGTGGTGTAGGTAAAGG
CACATTATCTGCTGCGTTAGCAAATAAATTAGGTTTTGCGCTACTTGATT
CCGGCGCGATTTATCGTATTAGCGCGTTAGCTGCTTTAAGACAAGGTATC
GCTTTTGACGATGAAGATGAATTAGCTAAATTAATTCCTACTTTAGCGAT
TGAATTTATCTCAAATAATGATGAAGTTACCGCTATTCTAAATGGTGAGA
ACGTAACAACACAGATCCGGAGTGCTGAAGCGGGTCAAAATGCCTCAAAA
ATTGCCATTTTCCCTAAAGTTCGTGCAGCTTTATTGCAAAGACAACGTGA
TTTTAGTTCACCTATGGGCTTGATTGCTGATGGGCGAGATATGGGAACCA
TCGTTTTTCCCGATGCTCAAGTCAAATTTTTTTTAGAGGCAAGCGCAGAA
GAACGCACTAAAAGACGTGTAAAACAGTTGCAAGAAAAAGGATTTAATGC
TAACTTTGGCGAGATTTTAGCCGAGATTAAAACGCGAGACTTGCGAGATA
GAACGCGCGCGGTGGTGCCATTAGTTCCAGCTAAAGATGCGTTATTATTA
GATTCTACGCATTTATCCATTGAAGAAGTAATTTCCCAAGCATTGGCGCA
TATTGCTAAATTCAAGAAATTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy