Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR980 IGR983 IGR987 IGR991 IGR985 IGR990 IGR981 IGR989 IGR986 IGR988 IGR982 IGR984 HD1343 himD,ihfB, - HD1353 HD1354 HD1349 HD1348 narQ, - HD1346 cmk, - HD1351 pyrF, - HD1356 HD1344 narQ, - HD1345 degS, - HD1350 HD1355 rpS1,rpsA, - HD1352 recJ, - HD1342 HD1343 himD,ihfB, - HD1353 HD1354 HD1349 HD1348 narQ, - HD1346 cmk, - HD1351 pyrF, - HD1356 HD1344 narQ, - HD1345 degS, - HD1350 HD1355 rpS1,rpsA, - HD1352 recJ, - HD1342 HD1354 HD1348 narQ, - HD1346 cmk, - HD1351 pyrF, - HD1356 HD1344 narQ, - HD1345 degS, - HD1350 HD1355 rpS1,rpsA, - HD1352 recJ, - HD1342 HD1343 himD,ihfB, - HD1353 HD1349
* Calculated from Protein Sequence

Gene ID: HD1350

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
degS  

Definition:
protease DegS precursor

Gene Start:
1104200

Gene Stop:
1105225

Gene Length:
1026

Molecular Weight*:
36431

pI*:
5.50

Net Charge*:
-4.08

EC:
3.4.21.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Secondary Evidence:
Vogel,R.F., Entian,K.D. and Mecke,D. Cloning and sequence of the mdh structural gene of Escherichia coli coding for malate dehydrogenase
Arch. Microbiol. 149 (1), 36-42 (1987)
Medline: 88105815

Bazan,J.F. and Fletterick,R.J.
Structural and catalytic models of trypsin-like viral proteases
Semin. Virol. 1, 311-322 (1990)Waller,P.R. and Sauer,R.T.
Characterization of degQ and degS, Escherichia coli genes encoding
homologs of the DegP protease
J. Bacteriol. 178 (4), 1146-1153 (1996)
Medline: 96165272


Comment:


Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to serine protease (protease DO) from H. influenzae (1170273), E. coli (729711), Helicobacter pylori(7445359), among others. HD1350 is 57% similar to residues 1-338 from DEGS_HAEIN.

HD1350 is similar to periplasmic serine protease DO from C. trachomatis (CT823), C. pneumoniae (CPn0979 ), T. pallidum (TP0773,TP0841, TP0546). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
BeTs to 13 clades of COG0265
COG name: Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain
Functional Class: O
The phylogenetic pattern of COG0265 is --t-yqvCEBRHuj--oLinX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000126 (Serine proteases, V8 family) with a combined E-value of 1.7e-07.
    IPB000126A    76-91
    IPB000126B    185-201


ProDom Summary:  Protein Domain Search
Residues 149-263 are 75% similar to a (PROTEASE SERINE HYDROLASE COMPLETE) protein domain (PD001397) which is seen in DEGS_HAEIN.

Residues 278-339 are 50% similar to a (PROTEASE PROTEOME COMPLETE SERINE) protein domain (PD346504) which is seen in Q9CMR4_PASMU.

Residues 75-135 are 67% similar to a (PROTEASE SERINE HYDROLASE PROTEOME) protein domain (PD001340) which is seen in Q9CMR4_PASMU.



Paralogs:  Local Blast Search
HD1350 is paralogously related to HD0260 (4e-44).


Pfam Summary:  Pfam Search
Residues 40 to 237 (E-value = 1.3e-19) place HD1350 in the Trypsin family which is described as Trypsin (PF00089)
Residues 240 to 323 (E-value = 2.6e-12) place HD1350 in the PDZ family which is described as PDZ domain (Also known as DHR or GLGF) (PF00595)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLKKIIRAAILGLFCAFLILYVAPIVNNNVDVLPQSSKKIASFHDAVNLA
SPAVVNVYNRSLDEKTSAFEVKNLGSGVVMTEDGYILTNKHVIEDAEQII
VAFQTGEISDAKLVGADTLTDLAVLKVHAQYLQTIPQNDERPIRIGDIVL
AIGNPFNLGQSISQGIISATGRNALTDGGRQNFIQTDASINRGNSGGALI
NSVGELIGINTLSLGKTNDELAEGLNFAIPINLAKQIMAKIIKDGRVIRG
YFGVNSTLYSNAENSDNGVLITGVAVNGPADEAGIKKNDRILKVGNIRAV
SPTQMMDVLANMKPGTQVNVQVLRDNHIFDVDVIIGEFPAL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAAAGAAGATCATTCGAGCGGCTATTTTGGGGCTTTTTTGTGCATT
TCTTATTCTATATGTAGCACCAATTGTTAATAATAACGTTGACGTACTAC
CGCAATCAAGTAAAAAAATAGCCAGTTTTCATGATGCGGTAAATTTGGCA
TCGCCTGCAGTAGTCAATGTATATAATCGCTCATTAGATGAAAAAACCAG
CGCTTTTGAGGTTAAAAATTTAGGTTCAGGCGTGGTAATGACTGAAGATG
GTTATATTTTAACCAATAAACATGTAATTGAAGATGCAGAACAAATTATT
GTTGCTTTTCAGACAGGTGAAATTTCTGATGCAAAATTAGTCGGCGCTGA
TACGTTAACAGATCTTGCCGTGTTAAAAGTTCATGCGCAATATTTACAGA
CTATTCCACAAAATGATGAACGACCTATCCGCATTGGTGATATCGTCTTA
GCTATTGGCAACCCATTTAATTTAGGGCAGAGTATTTCACAAGGCATTAT
TAGTGCTACAGGCCGTAATGCACTAACTGATGGTGGTCGTCAAAATTTTA
TTCAAACCGATGCGTCCATTAACCGTGGCAATTCTGGTGGCGCATTAATC
AATTCAGTCGGTGAATTAATCGGCATTAATACGCTCAGTTTAGGCAAAAC
AAATGATGAATTAGCAGAAGGATTAAATTTTGCTATTCCAATTAATTTAG
CTAAACAAATTATGGCGAAAATCATTAAAGATGGTCGAGTAATACGAGGC
TATTTTGGTGTTAATAGTACTTTATATTCTAACGCAGAGAATTCAGATAA
TGGCGTTTTGATTACCGGAGTAGCCGTAAATGGCCCGGCAGATGAAGCGG
GGATTAAAAAAAATGACCGCATTCTAAAAGTAGGCAATATTCGAGCCGTA
TCGCCCACTCAAATGATGGATGTATTGGCAAATATGAAACCCGGCACGCA
AGTCAACGTGCAAGTATTACGTGATAATCATATTTTTGATGTAGATGTGA
TAATTGGTGAATTTCCAGCACTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy