Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR980 IGR983 IGR987 IGR985 IGR990 IGR981 IGR989 IGR986 IGR988 IGR982 IGR984 HD1343 himD,ihfB, - HD1353 HD1354 HD1349 HD1348 narQ, - HD1346 cmk, - HD1351 HD1344 narQ, - HD1345 degS, - HD1350 HD1355 rpS1,rpsA, - HD1352 recJ, - HD1342 HD1343 himD,ihfB, - HD1353 HD1354 HD1349 HD1348 narQ, - HD1346 cmk, - HD1351 HD1344 narQ, - HD1345 degS, - HD1350 HD1355 rpS1,rpsA, - HD1352 recJ, - HD1342 himD,ihfB, - HD1353 HD1348 narQ, - HD1346 cmk, - HD1351 HD1344 narQ, - HD1345 degS, - HD1350 HD1355 rpS1,rpsA, - HD1352 recJ, - HD1342 HD1343 HD1354 HD1349
* Calculated from Protein Sequence

Gene ID: HD1349

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1103792

Gene Stop:
1104109

Gene Length:
318

Molecular Weight*:
11319

pI*:
6.90

Net Charge*:
-0.01

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-104 are 66% similar to 15603533 unknown [Pasteurella
multocida].

Otherwise, some significant hits using gapped BLAST to hypothetical protein from Listeria monocytogenes (466138), E. coli (7448438), Bacillus anthracis (6470196), among others. HD1349 is 52% similar to residues 1-105 from YORB_LISMO.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0393
COG name: Uncharacterized ACR, MJ1170 family
Functional Class: S
The phylogenetic pattern of COG0393 is aMTk--vce------------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002765 (Domain of unknown function DUF74) with a combined E-value of 1.8e-19.
    IPB002765A    44-83
    IPB002765B    97-105


ProDom Summary:  Protein Domain Search
Residues 1-104 are 66% similar to a (MJ1413 PROTEOME BH1111 COMPLETE) protein domain (PD385470) which is seen in Q9CKF3_PASMU.



Paralogs:  Local Blast Search
HD1349 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 105 (E-value = 3.8e-45) place HD1349 in the DUF74 family which is described as Domain of unknown function DUF74 (PF01906)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MIITTTPTVENRQIIEYKGLVFGEVVAGANIIRDFFASITDMIGGRSGVY
EDKLNVARQEALVELQKQARNIGANAVIGVSIQYQSMGKKDMFIIVATGT
AVVIG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTATTACGACAACCCCGACCGTTGAAAATCGGCAAATTATTGAATA
TAAAGGCTTAGTATTTGGAGAGGTTGTTGCAGGCGCAAATATTATTCGAG
ATTTTTTTGCAAGTATTACGGATATGATTGGTGGTCGTTCAGGTGTCTAT
GAAGATAAATTAAATGTAGCGCGCCAAGAAGCATTGGTCGAATTGCAAAA
ACAAGCAAGAAATATAGGCGCTAATGCTGTAATAGGTGTTTCTATACAAT
ATCAATCAATGGGCAAAAAAGATATGTTTATTATAGTAGCCACAGGTACA
GCGGTTGTGATTGGCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy