Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR980 IGR983 IGR978 IGR987 IGR985 IGR981 IGR979 IGR986 IGR988 IGR982 IGR984 HD1343 HD1349 HD1348 narQ, - HD1346 cmk, - HD1351 xprA,dsbC, - HD1340 HD1344 narQ, - HD1345 degS, - HD1350 HD1339 rpS1,rpsA, - HD1352 recJ, - HD1342 HD1343 HD1349 HD1348 narQ, - HD1346 cmk, - HD1351 xprA,dsbC, - HD1340 HD1344 narQ, - HD1345 degS, - HD1350 HD1339 rpS1,rpsA, - HD1352 recJ, - HD1342 HD1348 narQ, - HD1346 cmk, - HD1351 HD1344 narQ, - HD1345 degS, - HD1350 HD1339 rpS1,rpsA, - HD1352 recJ, - HD1342 HD1343 HD1349 xprA,dsbC, - HD1340
* Calculated from Protein Sequence

Gene ID: HD1346

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
narQ  

Definition:
nitrate/nitrite sensor protein NarQ

Gene Start:
1102291

Gene Stop:
1102965

Gene Length:
675

Molecular Weight*:
25274

pI*:
7.00

Net Charge*:
0.00

EC:
2.7.3.-  

Functional Class:
Regulatory functions; Other  

Pathway: pathway table

Secondary Evidence:
Rabin,R.S. and Stewart,V.
Either of two functionally redundant sensor proteins, NarX and
NarQ, is sufficient for nitrate regulation in Escherichia coli K-12
Proc. Natl. Acad. Sci. U.S.A. 89 (18), 8419-8423 (1992)
Medline: 92409527

Chiang,R.C., Cavicchioli,R. and Gunsalus,R.P.
Identification and characterization of narQ, a second nitrate
sensor for nitrate-dependent gene regulation in Escherichia coli
Mol. Microbiol. 6 (14), 1913-1923 (1992)
Medline: 92374842


Comment:


Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to nitrate/nitrite sensor protein NarQ from H. influenzae (1171657), E. coli (127837), and to NarX from E. coli (127840), Pseudomonas aeruginosa (2765451), among others. HD1346 is 54% similar to residues 342-566 from NARQ_HAEIN. HD1346 is 39% similar to residues 388-582 from NARX_ECOLI.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0642
COG name: Sensory transduction histidine kinases
Functional Class: T
The phylogenetic pattern of COG0642 is AMT-YQVCEBRHUJ--O-inX
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 137-219 are 56% similar to a (KINASE SENSOR COMPLETE PROTEOME SENSORY TRANSDUCTION) protein domain (PD005700) which is seen in Q9CKM1_PASMU.

Residues 21-94 are 63% similar to a (KINASE SENSOR TWO-COMPONENT PROTEOME COMPLETE SENSORY) protein domain (PD002447) which is seen in NARQ_HAEIN.

Residues 128-205 are 46% similar to a (KINASE COMPLETE PROTEOME HISTIDINE) protein domain (PD088883) which is seen in Q9KLR7_VIBCH.



Paralogs:  Local Blast Search
HD1346 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 129 to 222 (E-value = 3.5e-16) place HD1346 in the HATPase_c family which is described as Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MIGRSLYVLQVQKQQQQLVLMEERSIIARELHDSLAQSLTFFKIQISLLK
YNSETVKNWHKQKTILADFEKALNEAYSQLRELLSTFRLTIEEANLTCAL
ERVLDSLRSRTSAKISLNCKLPSQTFSAQQQVHALQIVREAVINAIKHSN
ATQIEVIAETNQDGEQCLIVRDNGNGIVNGIEPDDHYGLTIMKERAAQLK
GEFTIINRAEGGVQVMVTLPNTLL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCGGCCGTAGTCTATACGTTTTACAAGTACAAAAACAACAACAGCA
ATTAGTGTTGATGGAAGAGCGGTCGATTATTGCACGGGAATTGCATGATT
CATTGGCTCAGTCGCTCACTTTTTTTAAAATTCAAATTAGCTTATTGAAA
TATAATAGCGAAACGGTGAAAAATTGGCATAAACAGAAAACGATTTTAGC
GGATTTTGAAAAAGCGTTAAACGAGGCATATAGTCAGTTAAGAGAGCTAT
TATCGACTTTTCGCTTAACTATTGAAGAAGCTAATTTAACCTGTGCATTA
GAACGTGTTTTGGATTCGTTACGCTCACGAACTTCAGCAAAAATAAGTTT
AAATTGTAAATTGCCTTCGCAAACGTTTAGTGCTCAGCAACAAGTCCATG
CATTACAGATTGTGCGAGAAGCGGTCATTAATGCTATAAAACATTCAAAT
GCAACCCAAATTGAAGTGATTGCTGAAACTAATCAAGATGGCGAACAATG
TTTAATTGTACGCGATAATGGTAATGGAATCGTGAATGGCATTGAACCAG
ATGATCATTATGGGCTGACGATTATGAAAGAAAGAGCGGCACAATTAAAA
GGCGAATTTACTATTATCAATCGTGCTGAAGGCGGTGTACAAGTAATGGT
AACATTACCCAATACCTTACTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy