Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR980 IGR983 IGR978 IGR987 IGR985 IGR981 IGR979 IGR986 IGR988 IGR982 IGR984 HD1343 HD1349 HD1348 narQ, - HD1346 cmk, - HD1351 xprA,dsbC, - HD1340 HD1344 narQ, - HD1345 degS, - HD1350 HD1339 rpS1,rpsA, - HD1352 recJ, - HD1342 HD1343 HD1349 HD1348 narQ, - HD1346 cmk, - HD1351 xprA,dsbC, - HD1340 HD1344 narQ, - HD1345 degS, - HD1350 HD1339 rpS1,rpsA, - HD1352 recJ, - HD1342 HD1348 narQ, - HD1346 cmk, - HD1351 xprA,dsbC, - HD1340 HD1344 narQ, - HD1345 degS, - HD1350 HD1339 rpS1,rpsA, - HD1352 recJ, - HD1342 HD1343 HD1349
* Calculated from Protein Sequence

Gene ID: HD1345

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
narQ  

Definition:
nitrate/nitrite sensor protein

Gene Start:
1101365

Gene Stop:
1102273

Gene Length:
909

Molecular Weight*:
34670

pI*:
5.30

Net Charge*:
-5.92

EC:
2.7.3.-  

Functional Class:
Regulatory functions  

Pathway: pathway table
Type II secretion system

Secondary Evidence:
Rabin,R.S. and Stewart,V.
Either of two functionally redundant sensor proteins, NarX and NarQ, is sufficient for nitrate regulation in Escherichia coli K-12
Proc. Natl. Acad. Sci.U.S.A. 89 (18), 8419-8423 (1992)
MEDLINE: 92409527

Chiang,R.C., Cavicchioli,R. and Gunsalus,R.P.
Identification and characterization of narQ, a second nitrate sensor for nitrate-dependent gene regulation in Escherichia coli Mol. Microbiol. 6 (14), 1913-1923 (1992)
MEDLINE: 92374842

Chiang RC, Cavicchioli R, Gunsalus RP.
'Locked-on' and 'locked-off' signal transduction mutations in the periplasmic domain of the Escherichia coli NarQ and NarX sensors affect nitrate- and nitrite-dependent regulation by NarL and NarP.
Mol Microbiol. 1997 Jun;24(5):1049-60.
PMID: 9220011

Darwin AJ, Stewart V.
Expression of the narX, narL, narP, and narQ genes of Escherichia coli K-12: regulation of the regulators.
J Bacteriol. 1995 Jul;177(13):3865-9.
PMID: 7601854

Comment:
0

Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to nitrate/nitrite sensor protein NarQ from H. influenzae (1171657), E. coli (127837), Pseudomonas aeruginosa (2765451), among others. HD1345 is 38% similar to residues 33-334 from NARQ_HAEIN.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0642
COG name: Sensory transduction histidine kinases
Functional Class:  T
The phylogenetic pattern of COG0642 is AMT-YQVCEBRHUJ--O-inX
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 144-302 are 40% similar to a (PROTEOME COMPLETE KINASE SENSOR) protein domain (PD114039) which is seen in Q9CKM1_PASMU.

Residues 1-134 are 47% similar to a (SENSOR NITRATE/NITRITE SENSORY) protein domain (PD037838) which is seen in Q9CKM1_PASMU.

Residues 125-261 are 28% similar to a (PHOSPHORYLATION TRANSFERASE KINASE) protein domain (PD114050) which is seen in NARX_ECOLI.



Paralogs:  Local Blast Search
HD1345 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 124 to 194 (E-value = 9.4e-12) place HD1345 in the HAMP family which is described as HAMP domain (PF00672)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MWSNKSDAGLINVSGSLRMQSYRFLYEMEHHPNSIPSRLAEYRQSLNSPE
IKESLEYKCFLPTEVTERYDNLKQSWQAMEGFIINGDRDAYVANLEGYAR
QVNNFVWSLQSFAELKLKIAIGVIIVSMLLIIGLAYIGVWYTRKKIIAPL
NQLVVASRQIKNEDFDHVRLVVTEPNELGFLSSTFTQMASELAKLYASLE
EKVEDKTRRLISVNHSLLVLFQCSQLLSAKPLNQSVLYEVLQIILDNEHL
RAIEIQVYGADYWNVTIDNAPAQTWDFTEIAVENEKVARLGWKPSLLCPD
ER$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGGAGCAATAAATCTGATGCAGGGCTGATTAATGTTTCTGGTTCATT
ACGCATGCAAAGTTACCGTTTTTTATATGAAATGGAACACCACCCTAATT
CTATTCCATCACGGCTAGCTGAATATCGTCAAAGTTTAAACTCACCGGAG
ATTAAAGAATCATTAGAGTATAAATGTTTTTTACCGACTGAAGTGACGGA
GCGCTATGATAATTTAAAGCAAAGTTGGCAGGCAATGGAAGGCTTTATTA
TTAATGGCGACCGTGATGCGTATGTTGCAAATCTTGAAGGTTATGCACGG
CAAGTTAATAATTTTGTATGGTCATTGCAATCATTCGCTGAATTGAAGTT
GAAGATAGCGATTGGCGTAATTATTGTTTCAATGTTACTCATTATCGGTT
TAGCTTATATTGGCGTTTGGTATACCCGTAAAAAAATTATTGCGCCTTTA
AATCAATTAGTGGTTGCAAGTCGACAGATTAAAAATGAAGATTTTGATCA
TGTTCGATTAGTGGTAACAGAACCGAACGAATTAGGTTTTTTATCTTCTA
CCTTTACACAGATGGCCAGTGAATTGGCAAAACTTTATGCTTCATTAGAA
GAAAAAGTAGAGGATAAAACACGTCGCTTAATTTCTGTTAATCATTCATT
ATTAGTCCTCTTTCAATGCTCACAGCTTTTGAGCGCTAAACCGCTTAATC
AAAGCGTGTTGTATGAAGTATTACAAATCATTTTGGATAATGAACATTTA
CGTGCGATTGAAATTCAGGTCTATGGTGCAGATTATTGGAATGTCACGAT
TGATAATGCACCCGCACAAACATGGGATTTTACTGAAATAGCGGTTGAAA
ATGAAAAAGTCGCGCGATTAGGTTGGAAGCCGTCATTATTATGCCCAGAT
GAACGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy