Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR980 IGR983 IGR978 IGR985 IGR981 IGR979 IGR986 IGR982 IGR977 IGR984 IGR976 yebM,znuC, - HD1338 sucA, - HD1336 HD1343 HD1349 HD1348 narQ, - HD1346 xprA,dsbC, - HD1340 HD1344 narQ, - HD1345 degS, - HD1350 HD1339 recJ, - HD1342 yebM,znuC, - HD1338 sucA, - HD1336 HD1343 HD1349 HD1348 narQ, - HD1346 xprA,dsbC, - HD1340 HD1344 narQ, - HD1345 degS, - HD1350 HD1339 recJ, - HD1342 yebM,znuC, - HD1338 sucA, - HD1336 HD1348 narQ, - HD1346 xprA,dsbC, - HD1340 HD1344 narQ, - HD1345 degS, - HD1350 HD1339 recJ, - HD1342 HD1343 HD1349
* Calculated from Protein Sequence

Gene ID: HD1342

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
recJ  

Definition:
single-stranded-DNA-specific exonuclease

Gene Start:
1098530

Gene Stop:
1100251

Gene Length:
1722

Molecular Weight*:
63573

pI*:
5.80

Net Charge*:
-11.34

EC:
3.1.-.-  

Functional Class:
Replication; Degradation of DNA  

Pathway: pathway table

Secondary Evidence:
Lovett,S.T. and Kolodner,R.D.
Nucleotide sequence of the Escherichia coli recJ chromosomal region and construction of recJ-overexpression plasmids
J. Bacteriol. 173 (1), 353-364 (1991)
Medline: 91100304

Lovett,S.T. and Kolodner,R.D.
Identification and purification of a single-stranded-DNA-specific
exonuclease encoded by the recJ gene of Escherichia coli
Proc. Natl. Acad. Sci. U.S.A. 86 (8), 2627-2631 (1989)
Medline: 89202382


Comment:
From Genbank:[gi:1172895]
This enzyme is required for many types of recombinational events, althought the stringency of the requirement for recJ appears to vary with the type of recombinational event monitored and the other recombination gene products which are available.

For other "rec" genes, see HD0410 (recA), HD1076 (recB), HD1604 (recO), HD1921 (recG), HD0325 (recR), HD0411 (recX), HD0475 (recQ), HD0815 (recN), HD0849 (recF), HD0626 (recD).

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to single-stranded-DNA-specific exonuclease from H. influenzae (1172895), E. coli (2507106), Erwinia chrysanthemi (2507107), among others. HD1342 is 59% similar to residues 1-573 from RECJ_HAEIN.

HD1342 is similar to single-stranded-DNA-specific exonuclease from C. trachomatis (CT447), C. pneumoniae (CPn0563), and T. pallidum (TP0704). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0608
COG name: Single-stranded DNA-specific exonuclease
Functional Class: L
The phylogenetic pattern of COG0608 is AMTk-qvceB-hUJ--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001667 (DHH family) with a combined E-value of 5.3e-10.
    IPB001667A    75-88
    IPB001667B    152-159
    IPB001667C    422-430


ProDom Summary:  Protein Domain Search
Residues 19-80 are 53% similar to a (EXONUCLEASE PROTEOME COMPLETE) protein domain (PD112144) which is seen in RECJ_HAEIN.

Residues 82-201 are 69% similar to a (EXONUCLEASE PROTEOME COMPLETE) protein domain (PD003186) which is seen in RECJ_HAEIN.

Residues 103-203 are 56% similar to a (EXONUCLEASE PROTEOME COMPLETE RECJ) protein domain (PD017509) which is seen in Q9L4D5_XANCA.

Residues 497-573 are 54% similar to a (EXONUCLEASE SINGLE-STRANDED-DNA-SPECIFIC) protein domain (PD024656) which is seen in Q9CP64_PASMU.

Residues 352-496 are 66% similar to a (EXONUCLEASE PROTEOME COMPLETE) protein domain (PD009926) which is seen in RECJ_HAEIN.

Residues 217-327 are 67% similar to a (EXONUCLEASE PROTEOME COMPLETE) protein domain (PD007759) which is seen in Q9KPF1_VIBCH.



Paralogs:  Local Blast Search

HD1342 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 63 to 227 (E-value = 6.1e-48) place HD1342 in the DHH family which is described as DHH family (PF01368)
Residues 376 to 447 (E-value = 6.9e-11) place HD1342 in the DHHA1 family which is described as DHHA1 domain (PF02272)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VQKLIKQRPQLTTLTLSANPLLNRLYQSRNIATLHDLERGLEYLHRPQLL
ANIDQAVALLIEAFQTDMRIVIVGDFDADGATSTALTILALRQLGFAKVD
YLIPDRFSQGYGLSLAVAEAVLAKGADLVITVDNGISSFEGVELLKSQGI
KVLVTDHHLPAEKLPDADALINPNLVNCDFPSKALAGVGVAFYVMLALRS
RMRELALFKVAEPNLAELLDLVALGTVADVVPFDHNNRILVHQGLNRIRS
GCCRPGIRALADIAKRDLSSLQAADLGFAIAPRLNAAGRLENMSLGVELL
ITDNIALAHQLAFELDSLNQKRKAFEQEMKAEALAICAKLPSLMQKEQAH
GIVLYQADWHQGVIGILASRIKDQFHRPVIAFAQESEDSVYLKGSARSIA
GLHMRDVLERIDSTYPNLIVKFGGHAMAAGLTIHQDDFSTFQTVFDEIVD
QFISPEQLQGVIYTDGELQADEMTLEIAELLQSAGPWGQHFPEPLFEGQC
RILQQRILAGKHLKLMIQFNDRFELYDAIWFNVDLRTFPDLSIKHAQIVY
KLDINEFRGNKNIQLRVESLIPL$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCAAAAATTAATTAAACAACGACCTCAACTCACTACGCTGACGTTATC
CGCTAATCCTTTATTAAATCGCCTTTATCAAAGCCGTAATATTGCTACTT
TACACGATTTAGAGCGGGGATTGGAATATCTTCATCGACCACAATTATTA
GCGAATATTGATCAAGCAGTGGCGTTATTGATTGAAGCATTTCAAACAGA
TATGCGGATTGTTATTGTGGGAGATTTTGACGCGGATGGCGCAACGAGTA
CCGCTTTGACTATCTTGGCTTTACGTCAATTAGGCTTTGCTAAAGTAGAT
TATTTAATCCCCGATCGTTTTTCGCAAGGTTATGGGTTGAGTTTAGCGGT
TGCTGAAGCTGTGTTAGCCAAAGGTGCAGATTTAGTTATTACGGTAGATA
ATGGCATTTCATCGTTTGAAGGTGTTGAGTTACTCAAATCTCAGGGAATA
AAGGTATTAGTGACCGATCACCACTTACCTGCGGAAAAATTACCGGATGC
GGATGCATTAATTAATCCAAATTTGGTAAATTGTGATTTCCCTTCTAAGG
CACTTGCGGGGGTAGGTGTTGCATTTTATGTGATGTTGGCACTAAGAAGT
CGGATGCGGGAATTAGCATTATTTAAAGTAGCAGAACCTAATTTAGCTGA
ATTGCTTGATTTGGTGGCGTTAGGCACTGTTGCAGATGTAGTACCATTTG
ATCACAATAACCGAATTTTAGTCCATCAAGGTTTGAATCGTATTCGTTCA
GGTTGTTGCCGACCTGGCATTCGTGCTTTAGCCGATATTGCTAAACGTGA
TTTAAGTAGCTTACAAGCGGCCGATCTTGGTTTTGCAATTGCACCTCGTT
TAAATGCAGCGGGTCGATTAGAGAATATGTCGTTGGGCGTTGAGCTATTA
ATCACCGATAATATTGCGTTAGCTCATCAGTTAGCTTTTGAGCTTGATAG
TCTTAACCAAAAGCGTAAAGCGTTTGAGCAAGAAATGAAAGCGGAAGCAT
TAGCTATTTGTGCGAAATTACCTAGTTTGATGCAAAAAGAACAAGCGCAC
GGTATTGTGTTATATCAAGCAGATTGGCATCAGGGCGTGATCGGTATTTT
AGCTTCCCGAATTAAAGATCAATTTCATCGTCCTGTGATTGCCTTTGCTC
AAGAAAGTGAAGACAGTGTTTATTTGAAAGGCTCAGCACGTTCTATTGCC
GGGTTGCATATGCGTGATGTATTAGAAAGAATTGATTCAACCTATCCAAA
TCTGATTGTTAAATTTGGCGGCCATGCGATGGCAGCGGGTTTAACTATTC
ATCAAGATGACTTCTCAACGTTTCAAACTGTTTTTGATGAAATCGTGGAT
CAATTTATTTCACCAGAACAATTACAGGGCGTTATTTATACAGATGGTGA
ATTACAAGCAGATGAAATGACACTTGAAATAGCAGAATTATTACAGTCTG
CGGGCCCTTGGGGACAACATTTTCCTGAGCCACTTTTTGAAGGACAGTGT
CGGATTTTACAACAACGTATTTTGGCGGGTAAGCACTTAAAATTAATGAT
TCAATTCAATGATCGTTTTGAGTTATATGATGCGATTTGGTTTAATGTGG
ATCTTCGTACTTTCCCTGATTTATCAATTAAGCACGCGCAAATAGTGTAT
AAATTGGATATTAATGAATTTAGAGGCAATAAAAATATACAGTTAAGAGT
TGAAAGCCTAATACCGCTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy