Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR980 IGR983 IGR978 IGR981 IGR979 IGR982 IGR977 IGR984 IGR976 yebM,znuC, - HD1338 sucA, - HD1336 HD1343 narQ, - HD1346 xprA,dsbC, - HD1340 HD1344 narQ, - HD1345 HD1339 recJ, - HD1342 yebM,znuC, - HD1338 sucA, - HD1336 HD1343 narQ, - HD1346 xprA,dsbC, - HD1340 HD1344 narQ, - HD1345 HD1339 recJ, - HD1342 yebM,znuC, - HD1338 sucA, - HD1336 narQ, - HD1346 xprA,dsbC, - HD1340 HD1344 narQ, - HD1345 HD1339 recJ, - HD1342 HD1343
* Calculated from Protein Sequence

Gene ID: HD1340

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
xprA  dsbC  

Definition:
thiol:disulfide interchange protein

Gene Start:
1097751

Gene Stop:
1098446

Gene Length:
696

Molecular Weight*:
25454

pI*:
8.10

Net Charge*:
2.11

EC:
5.3.4.1  

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table
Biosynthesis and degradation of glycoprotein

Secondary Evidence:
Lovett,S.T. and Kolodner,R.D.
Nucleotide sequence of the Escherichia coli recJ chromosomal region and construction of recJ-overexpression plasmids
J. Bacteriol. 173 (1), 353-364 (1991)
MEDLINE: 91100304

Missiakas,D., Georgopoulos,C. and Raina,S.
The Escherichia coli dsbC (xprA) gene encodes a periplasmic protein involved in disulfide bond formation
EMBO J. 13 (8), 2013-2020 (1994)
MEDLINE: 94222049

Shevchik,V.E., Condemine,G. and Robert-Baudouy,J.
Characterization of DsbC, a periplasmic protein of Erwinia
chrysanthemi and Escherichia coli with disulfide isomerase activity
EMBO J. 13 (8), 2007-2012 (1994)
MEDLINE: 94222048


Comment:
For other "dsb" genes, see HD0807 (dsbD), HD0638 (dsbA), HD0616 (dsbE), HD1729 (dsbB).

Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to thiol:disulfide interchange protein from H. influenzae (1169427), E. coli (729371), Erwinia chrysanthemi (729372), among others. HD1340 is 57% similar to residues 1-229 from DSBC_HAEIN.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 106-219 are 74% similar to a (INTERCHANGE THIOL:DISULFIDE PROTEOME) protein domain (PD013570) which is seen in DSBC_HAEIN.

Residues 18-226 are 35% similar to a (INTERCHANGE PLASMID THIOL:DISULFIDE DSBC) protein domain (PD329107) which is seen in Q9KPF0_VIBCH.



Paralogs:  Local Blast Search
HD1340 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1EEJ|A Chain A, Crystal Structure Of The Protein Disulfide ... 198 4e-052

Gene Protein Sequence:
MRKTAIALFGLSFVNLSAMAGDANLQRILENMGATNVSIQDSVLPGFRTA
VSNQGVMQISETGRYVIQGKIFELQNNKARDITNKALLTELNALEKEMII
YPAKQEKHVVTVFMDISCHYCHLLHKQLKEYNDLGITIRFLAFPRGGMNT
QTAKQMEAIWTSSDRVKALNDAENGVLPTSLASPNLVKKHFELGSKFGVV
GTPNIVSSQGELIAGYVEPKDLAKLLSELDQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGGAAAACGGCAATTGCATTATTTGGTTTATCATTCGTTAATCTTTC
AGCGATGGCAGGTGATGCAAATTTACAGCGTATTTTAGAGAATATGGGTG
CTACTAATGTTAGTATTCAAGATTCGGTTTTACCGGGATTTCGAACGGCA
GTATCTAATCAGGGCGTGATGCAAATTAGTGAAACGGGTCGTTATGTTAT
TCAAGGTAAAATATTTGAATTACAAAATAATAAGGCGCGTGATATTACTA
ATAAAGCATTATTAACTGAACTTAATGCGTTAGAAAAAGAAATGATTATT
TATCCGGCTAAACAAGAGAAACATGTTGTAACCGTGTTTATGGATATTAG
TTGTCATTATTGCCATTTATTACATAAGCAGTTAAAAGAATATAATGATT
TAGGTATTACTATCCGCTTCTTGGCGTTTCCTCGTGGCGGTATGAATACG
CAAACGGCTAAACAAATGGAAGCTATTTGGACCTCAAGCGATCGTGTTAA
AGCGTTAAATGATGCGGAAAACGGGGTGTTGCCAACATCTTTAGCATCAC
CTAATTTAGTGAAAAAACATTTTGAATTGGGATCAAAATTCGGTGTGGTT
GGCACGCCAAATATAGTGAGTAGTCAAGGTGAATTAATTGCGGGTTATGT
TGAGCCAAAAGACTTAGCTAAATTGTTGAGTGAATTAGACCAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy