Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR974 IGR978 IGR973 IGR979 IGR975 IGR977 IGR976 yebM,znuC, - HD1338 lapB, - HD1332 sucB, - HD1334 sucA, - HD1336 xprA,dsbC, - HD1340 HD1339 pckA,ppc, - HD1331 recJ, - HD1342 yebM,znuC, - HD1338 lapB, - HD1332 sucB, - HD1334 sucA, - HD1336 xprA,dsbC, - HD1340 HD1339 pckA,ppc, - HD1331 recJ, - HD1342 yebM,znuC, - HD1338 lapB, - HD1332 sucB, - HD1334 sucA, - HD1336 HD1339 pckA,ppc, - HD1331 recJ, - HD1342 xprA,dsbC, - HD1340
* Calculated from Protein Sequence

Gene ID: HD1336

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
sucA  

Definition:
2-oxoglutarate dehydrogenase E1 component

Gene Start:
1095045

Gene Stop:
1092184

Gene Length:
2862

Molecular Weight*:
108495

pI*:
7.00

Net Charge*:
0.00

EC:
1.2.4.2  

Functional Class:
Energy metabolism; TCA cycle  

Pathway: pathway table
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism

Secondary Evidence:
Darlison,M.G., Spencer,M.E. and Guest,J.R.
Nucleotide sequence of the sucA gene encoding the 2-oxoglutarate dehydrogenase of Escherichia coli K12.
Eur. J. Biochem. 141(2): 351-359,
Medline: 84236168.

Schulze,E., Westphal,A.H., Hanemaaijer,R. and de Kok,A.
The 2-oxoglutarate dehydrogenase complex from Azotobacter vinelandii. 1. Molecular cloning and sequence analysis of the gene encoding the 2-oxoglutarate dehydrogenase component.
Eur. J. Biochem. 187(1): 229-234, 1990.
Medline: 90126823.

Westphal,A.H. and de Kok,A.
The 2-oxoglutarate dehydrogenase complex from Azotobacter vinelandii. 2. Molecular cloning and sequence analysis of the gene encoding the succinyltransferase component.
Eur. J. Biochem. 187(1): 235-239, 1990.
Medline: 90126825.

Park SJ, Chao G, Gunsalus RP.
Aerobic regulation of the sucABCD genes of Escherichia coli, which encode alpha-ketoglutarate dehydrogenase and succinyl coenzyme A synthetase: roles of ArcA, Fnr, and the upstream sdhCDAB promoter.
J Bacteriol. 1997 Jul;179(13):4138-42.
PMID: 9209026


Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to oxoglutarate dehydrogenase E1 component/alpha-ketoglutarate dehydrogenase from H. influenzae (1171886), E. coli (2506963), Azotobacter vinelandii (129036), among others. HD1336 is 75% similar to residues 3-917 from ODO1_HAEIN.

HD1336 is similar to oxoglutarate dehydrogenase from C. pneumoniae (CPn0378), C. trachomatis (CT054), and to pyruvate dehydrogenase E1 component alpha subunit from M. pneumoniae (MP0445). No similarities to U. urealyticum, T. pallidum, or M. genitalium.


COGS Summary:  COGS Search
BeTs to 6 clades of COG0567
COG name: Pyruvate and 2-oxoglutarate dehydrogenases, E1 component
Functional Class:  C
The phylogenetic pattern of COG0567 is ----y---ebrh------inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 355-532 are 62% similar to a (SYNTHASE THIAMINE DEHYDROGENASE PYROPHOSPHATE PYRUVATE) protein domain (PD000580) which is seen in ODO1_AZOVI.

Residues 104-269 are 72% similar to a (DEHYDROGENASE 2-OXOGLUTARATE E1 COMPONENT) protein domain (PD004732) which is seen in ODO1_HAEIN.

Residues 28-75 are 45% similar to a (DEHYDROGENASE E1 2-OXOGLUTARATE COMPONENT) protein domain (PD006490) which is seen in ODO1_HAEIN.

Residues 485-532 are 75% similar to a (DEHYDROGENASE E1 2-OXOGLUTARATE COMPONENT) protein domain (PD413672) which is seen in ODO1_HAEIN.

Residues 572-935 are 81% similar to a (DEHYDROGENASE 2-OXOGLUTARATE E1 COMPONENT) protein domain (PD403297) which is seen in ODO1_HAEIN.

Residues 270-358 are 76% similar to a (DEHYDROGENASE 2-OXOGLUTARATE E1 COMPONENT) protein domain (PD148184) which is seen in ODO1_HAEIN.



Paralogs:  Local Blast Search

HD1336 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 225 to 549 (E-value = 1.1e-38) place HD1336 in the E1_dh family which is described as Dehydrogenase E1 component (PF00676)
Residues 611 to 805 (E-value = 1.1e-71) place HD1336 in the Transket_pyr family which is described as Transketolase, pyridine binding domain (PF02779)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VYIIALNFISKIQGQAFMQHNNFEDWLASSVFGGSNQAYVEQIYEQYLEN
PANVDQSWRLIFDQFPSSSSKEHCHSQIRYHFRQLARKHHTNTMKVSDPT
ANTKQVRLRQWINAHRFRGYLEAKLDPLGYYGWKTSQVPELDYRYHGFTE
ADLNETVTLGQYVYGKESMKLADLAEALKTTYLGSIGLEFMHVQDAEQRN
WLQSKIESLCQQPLFTAQEKTNLLSELTATDGLERYLGAKFPGAKRFSLE
GSDAFIPMMKEIIRHASRQGVEHIVMGMTHRGRLNMLVNVLGKKPADLFA
EFAGKPADVQRTGDVKYHQGYASLFEVEDKNVHLTLAFNPSHLEIVNPVV
IGAVRARQQRLQDTEYNKVLAVSVHGDSAVAGQGVVQETLNMANARGYKV
GGSIRIVINNQIGFTTSNPTDTRSTEFCTDIAKMIQSPIIHVNGDDPEAV
AFAARMAVEYRTLFKRDIFIDLISYRRHGHNEADEPAATQPMMYQLIKKH
PIPRKIYADRLIREGLLTENQVTAMANHYRDALDQGECVMAESRALDKTK
SEWLQYLNDDLSAPYQSKFASERFNTLAERLCQLPEHLQLHSRVEKIYHD
RKQMYQGQKLFDWGMAETMAYATLLDEGIPIRLSGEDAGRGTFFHRHAVI
HNQQDGSNYIPLTHLHAQQARFEVWDSVLSEEAVLAFEYGYAITDPKTLT
IWEAQFGDFANGAQIVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHS
SARLERYLQLCAQRNMQVCVPTTPAQVYHMLRRQALRKIRRPLIALSPKS
LLRHPLAVSSLTELTEGQFQTVIAEIDQHIEASKVTRIIMCSGKVYYDLL
EQRRQNNQTDIAIIRIEQLYPFPLAELTAIIANYPQVTDFIWCQEEPLNQ
GAWYCSKHNFEAAIPAKAKLSYVGRPASASPAVGYIALHLEQQQQLIEQA
LTR$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTATATAATAGCGCTAAATTTTATCAGCAAAATACAAGGTCAGGCATT
TATGCAACATAATAATTTTGAAGATTGGTTAGCATCCTCCGTTTTTGGCG
GCTCAAATCAAGCTTATGTTGAACAAATATATGAACAATATCTTGAGAAC
CCCGCAAACGTGGATCAAAGCTGGCGTTTAATTTTCGATCAATTCCCATC
TAGCTCATCTAAAGAACATTGTCACTCCCAAATTCGCTATCATTTCCGTC
AACTTGCCCGCAAACACCACACCAACACCATGAAGGTTTCAGATCCCACC
GCTAACACGAAACAAGTACGGTTACGCCAATGGATCAATGCACACCGCTT
CCGTGGGTATTTAGAAGCCAAACTAGACCCGCTAGGTTATTACGGTTGGA
AAACGTCACAAGTACCTGAATTAGATTACCGCTATCACGGCTTTACTGAG
GCTGATCTAAACGAAACCGTTACCCTTGGACAATACGTGTATGGCAAAGA
AAGCATGAAGCTTGCTGATCTTGCCGAAGCATTAAAAACTACTTACCTCG
GTAGTATTGGTCTAGAATTTATGCATGTGCAAGATGCTGAACAACGTAAT
TGGTTACAAAGTAAAATTGAAAGTCTATGCCAACAACCACTCTTTACTGC
ACAAGAAAAAACCAATTTACTCAGTGAACTGACCGCTACTGATGGGCTAG
AACGCTATTTAGGTGCAAAATTCCCCGGCGCTAAACGCTTTTCATTAGAA
GGCTCTGATGCCTTTATTCCAATGATGAAAGAAATTATCCGCCACGCCTC
TCGCCAAGGCGTAGAACATATCGTAATGGGTATGACGCATCGTGGCAGAC
TTAATATGCTAGTCAATGTACTTGGCAAAAAACCGGCTGATTTATTTGCT
GAATTTGCCGGTAAACCGGCTGATGTACAACGAACTGGCGATGTTAAATA
TCATCAAGGTTATGCTTCACTTTTTGAAGTTGAAGATAAAAACGTTCACC
TAACCTTGGCGTTTAATCCATCACATCTAGAAATTGTCAACCCAGTAGTT
ATTGGCGCTGTTCGAGCCCGCCAACAACGTTTACAAGACACTGAATACAA
TAAAGTGTTAGCGGTCTCAGTGCACGGTGATTCTGCCGTCGCTGGACAAG
GTGTTGTGCAAGAAACATTAAATATGGCCAATGCACGCGGTTATAAAGTA
GGGGGTAGCATTCGAATTGTAATTAACAATCAAATTGGATTCACTACCTC
AAATCCAACAGATACTCGCTCGACGGAATTCTGTACGGATATAGCTAAAA
TGATTCAATCGCCGATTATCCATGTCAATGGTGATGATCCTGAAGCGGTC
GCTTTTGCTGCCAGAATGGCGGTTGAATACCGCACATTATTCAAACGAGA
TATCTTTATTGATCTCATATCCTATCGCCGTCATGGTCATAATGAAGCGG
ATGAACCCGCTGCCACACAGCCTATGATGTATCAGCTAATCAAAAAACAT
CCTATCCCACGTAAAATCTATGCCGATCGTTTAATCAGGGAAGGGCTATT
AACAGAAAATCAGGTAACCGCTATGGCTAATCACTATCGCGATGCTCTCG
ATCAAGGCGAGTGCGTAATGGCAGAATCCCGCGCGCTCGACAAGACGAAA
AGCGAGTGGTTACAATATCTCAATGATGATTTAAGCGCTCCGTATCAGAG
CAAATTTGCTAGTGAACGCTTTAACACTTTAGCCGAACGACTTTGTCAGC
TTCCTGAGCATTTACAGCTACATTCAAGGGTTGAAAAAATCTACCACGAC
CGCAAACAAATGTATCAAGGCCAAAAATTATTTGATTGGGGAATGGCAGA
AACGATGGCGTATGCCACCTTATTAGATGAAGGTATCCCGATTCGGTTGT
CTGGCGAAGATGCCGGCCGCGGTACATTTTTCCATCGGCATGCCGTTATT
CATAATCAACAAGATGGAAGCAATTATATACCTTTAACACATTTACATGC
TCAACAAGCTCGCTTTGAAGTCTGGGATTCCGTCCTCTCTGAAGAAGCTG
TATTAGCATTTGAGTATGGCTATGCTATAACAGATCCTAAAACCTTAACC
ATCTGGGAAGCACAATTTGGTGACTTTGCGAATGGTGCTCAAATTGTGAT
TGACCAATTTATTAGTTCAGGCGAACAAAAATGGGGAAGAATGTGTGGCT
TAGTGATGTTATTACCTCACGGTTATGAAGGTCAAGGTCCTGAGCACTCC
TCTGCACGCTTAGAACGTTACTTACAACTTTGTGCCCAACGGAATATGCA
AGTTTGTGTCCCCACAACGCCAGCACAAGTCTACCATATGTTACGCCGCC
AAGCGCTCAGAAAAATACGCCGACCGTTGATTGCACTTTCACCCAAATCG
CTATTACGCCATCCATTGGCGGTGTCTAGCTTAACAGAATTAACAGAAGG
TCAATTCCAAACGGTTATCGCTGAAATCGACCAACATATCGAAGCAAGCA
AAGTAACGCGCATTATTATGTGCTCAGGCAAAGTTTATTACGATCTACTC
GAACAACGTCGCCAAAATAACCAAACAGATATTGCGATCATTCGGATTGA
ACAGCTTTATCCATTCCCATTAGCAGAGTTAACCGCAATAATCGCAAACT
ATCCACAAGTTACTGATTTTATCTGGTGCCAAGAAGAACCATTAAATCAA
GGGGCTTGGTATTGCAGTAAACATAATTTTGAAGCAGCCATACCTGCCAA
AGCTAAACTGAGCTATGTCGGCCGTCCGGCCTCTGCCTCACCGGCGGTAG
GGTATATTGCTTTACATCTAGAACAACAACAACAACTGATTGAACAAGCA
TTAACGCGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy