Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR971 IGR974 IGR973 IGR975 IGR972 IGR970 ispF, - HD1328 ispD, - HD1329 lapB, - HD1332 sucB, - HD1334 sucA, - HD1336 pckA,ppc, - HD1331 hhdA, - HD1327 ispF, - HD1328 ispD, - HD1329 lapB, - HD1332 sucB, - HD1334 sucA, - HD1336 pckA,ppc, - HD1331 hhdA, - HD1327 ispF, - HD1328 ispD, - HD1329 lapB, - HD1332 sucB, - HD1334 sucA, - HD1336 HD1330 HD1330 pckA,ppc, - HD1331 hhdA, - HD1327
* Calculated from Protein Sequence

Gene ID: HD1331

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pckA  ppc  

Definition:
phosphoenolpyruvate carboxykinase/carboxylase

Gene Start:
1088271

Gene Stop:
1089887

Gene Length:
1617

Molecular Weight*:
59479

pI*:
5.60

Net Charge*:
-10.25

EC:
4.1.1.49  

Functional Class:
Energy metabolism; Fermentation  
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
Carbon fixation
Citrate cycle (TCA cycle)
Pyruvate metabolism

Secondary Evidence:
Medina,V., Pontarollo,R., Glaeske,D., Tabel,H. and Goldie,H. Sequence of the pckA gene of Escherichia coli K-12: relevance to genetic and allosteric regulation and homology of E. coli phosphoenolpyruvate carboxykinase with the enzymes from Trypanosoma brucei and Saccharomyces cerevisiae.
J. Bacteriol. 172(12): 7151-7156, 1990.
Medline: 91072271.

Laivenieks,M., Vieille,C. and Zeikus,J.G.
Cloning, sequencing, and overexpression of the Anaerobiospirillum succiniciproducens phosphoenolpyruvate carboxykinase (pckA) gene. Appl. Environ. Microbiol. 63(6): 2273-2280, 1997.
Medline: 97316436.

Velayudhan J, Kelly DJ.
Analysis of gluconeogenic and anaplerotic enzymes in Campylobacter jejuni: an essential role for phosphoenolpyruvate
carboxykinase.
Microbiology. 2002 Mar;148(Pt 3):685-94.
PMID: 11882702

Prost JF, Cozzone AJ.
Detection of an extended-10 element in the promoter region of the pckA gene encoding phosphoenolpyruvate carboxykinase in
Escherichia coli.
Biochimie. 1999 Mar;81(3):197-200.
PMID: 10385000

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to phosphoenolpyruvate carboxykinase (ATP) from H. influenzae (1172573), E. coli (1172572), Anaerobiospirillum succiniciproducens (3122621), among others.

Positions 2 to 535 are 90.3% (E value 0.0) similar to sp|P43923|PPCK_HAEIN phosphoenolpyruvate carboxykinase [ATP] between positions 4 and 537 in Haemophilus influenzae Rd. Positions 7 to 537 are 85.3% (E value 0.0) similar to pdb|1AYL| phosphoenolpyruvate carboxykinase between positions 10 and 541 in Escherichia coli.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1866
COG name: Phosphoenolpyruvate carboxykinase
Functional Class:  C
The phylogenetic pattern of COG1866 is ----y---eb-h---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001272 (Phosphoenolpyruvate carboxykinase (ATP)) with a combined E-value of 4.5e-221.
    IPB001272A    46-80
    IPB001272B    122-166
    IPB001272C    197-220
    IPB001272D    237-278
    IPB001272E    317-340
    IPB001272F    368-421
    IPB001272G    426-442
    IPB001272H    455-498


ProDom Summary:  Protein Domain Search
Residues 448-535 are 81% similar to a (CARBOXYKINASE PHOSPHOENOLPYRUVATE ATP) protein domain (PD025270) which is seen in Q9CKR4_PASMU.

Residues 28-98 are 80% similar to a (CARBOXYKINASE PHOSPHOENOLPYRUVATE ATP LYASE) protein domain (PD004723) which is seen in Q9CKR4_PASMU.

Residues 82-124 are 74% similar to a (CARBOXYKINASE PHOSPHOENOLPYRUVATE) protein domain (PD405605) which is seen in PPCK_HAEIN.

Residues 128-216 are 88% similar to a (CARBOXYKINASE PHOSPHOENOLPYRUVATE ATP) protein domain (PD407632) which is seen in PPCK_HAEIN.

Residues 217-441 are 83% similar to a (CARBOXYKINASE PHOSPHOENOLPYRUVATE ATP) protein domain (PD339491) which is seen in Q9CKR4_PASMU.

Residues 11-124 are 38% similar to a (CARBOXYKINASE PROTEOME) protein domain (PD395292) which is seen in Q9PP01_CAMJE.



Paralogs:  Local Blast Search
HD1331 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1AYL| Phosphoenolpyruvate Carboxykinase 829 0.0
pdb|1AQ2| Phosphoenolpyruvate Carboxykinase 827 0.0
pdb|1OEN| Phosphoenolpyruvate Carboxykinase 806 0.0

Gene Protein Sequence:
MLSRIEQELAQLGITNVKEIVHNPSYEQLFEEEMKPGLDGFEKGVLTNSG
AVAVDTGIFTGRSPKDKYIVYDETTKDNVWWTSEAVKNDNKPMSQSTWEN
LKDVVTHQLSNKRLFVIDAFCGASKTHRLAVRIITEVAWQAHFVKNMFIR
PTADELKVFEPNFVVMNGSKVTNPNWQAQGLNSENFVAFNLTERIQLIGG
TWYGGEMKKGMFSMMNYLLPLKNVASMHCSANVGKEGDVAVFFGLSGTGK
TTLSTDPKRKLIGDDEHGWDEHGVFNYEGGCYAKTINLSEENEPDIYRAI
RRDALLENVVVAEDGSIDFADKSKTENTRVSYPIYHIDNIVEPVSKAGHA
QKVIFLTADAFGVLPPVAKLTPEQTKYYFLSGFTAKLAGTERGITEPTPT
FSACFGAAFLSLHPTKYAEVLVQRMEAAGSQAYLVNTGWNGTGKRISIKD
TRGIIDAILDGSIEKATTHALPVFDLRVPDALPGVDTAILDPRDTYAEAA
EWHAKAEDLAARFVKNFEKYTTNEEGKALVAAGPQLSK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAAGCCGTATTGAACAAGAACTAGCACAACTAGGCATTACTAACGT
GAAAGAGATCGTACATAATCCTAGTTACGAACAGCTATTTGAAGAAGAAA
TGAAACCCGGCCTTGATGGGTTTGAAAAAGGTGTGCTGACAAATTCTGGT
GCGGTAGCAGTTGATACGGGTATTTTTACAGGGCGCTCACCCAAAGATAA
GTATATTGTTTATGATGAAACAACGAAAGATAATGTTTGGTGGACATCTG
AAGCGGTAAAAAATGATAATAAACCGATGAGCCAAAGCACTTGGGAAAAT
TTAAAAGATGTAGTAACGCATCAATTATCTAACAAACGTTTATTTGTGAT
TGATGCTTTTTGTGGCGCAAGTAAAACGCATCGTTTAGCGGTTCGTATTA
TTACTGAGGTAGCTTGGCAGGCACATTTTGTTAAGAATATGTTTATTCGT
CCAACAGCGGACGAATTAAAGGTATTTGAACCAAATTTTGTCGTGATGAA
CGGCTCAAAAGTAACCAATCCAAATTGGCAAGCACAAGGTTTAAACTCAG
AAAACTTTGTTGCCTTTAACTTGACTGAGCGTATTCAGTTAATTGGTGGT
ACTTGGTACGGTGGTGAGATGAAAAAAGGAATGTTCTCAATGATGAACTA
CTTGTTGCCACTTAAAAATGTTGCTTCAATGCATTGTTCTGCTAACGTGG
GTAAAGAGGGGGATGTAGCGGTTTTCTTTGGTTTGTCGGGCACAGGTAAA
ACTACTCTTTCTACTGATCCAAAACGTAAGCTAATCGGTGATGATGAACA
TGGCTGGGATGAGCATGGTGTGTTCAACTATGAAGGTGGTTGTTATGCGA
AAACGATTAATCTGTCTGAGGAAAATGAACCAGATATTTATCGCGCGATT
CGCCGTGATGCATTATTAGAAAATGTTGTGGTGGCGGAAGACGGATCTAT
TGATTTTGCTGATAAATCTAAGACTGAAAATACGCGTGTTTCTTATCCAA
TCTATCATATTGATAATATTGTTGAACCTGTTTCAAAAGCTGGTCATGCA
CAAAAAGTTATTTTCTTAACCGCTGATGCGTTTGGTGTATTGCCACCGGT
GGCTAAGTTGACGCCAGAACAGACTAAATATTATTTCTTATCTGGATTTA
CGGCTAAATTAGCCGGCACTGAACGTGGTATTACTGAACCAACGCCGACT
TTCTCTGCGTGTTTTGGTGCGGCATTCTTATCTTTACATCCGACCAAATA
TGCGGAAGTATTAGTGCAACGGATGGAAGCCGCTGGTTCACAAGCTTACT
TGGTAAATACCGGCTGGAATGGAACAGGTAAACGTATTTCGATTAAAGAT
ACGCGTGGTATTATTGATGCGATTTTAGATGGTTCAATTGAGAAAGCCAC
AACGCATGCGTTGCCAGTGTTTGACTTGAGGGTGCCTGATGCTTTACCGG
GTGTTGATACTGCAATTTTAGATCCGCGTGATACTTATGCAGAAGCAGCA
GAATGGCATGCTAAAGCTGAAGATCTAGCGGCACGTTTTGTGAAAAACTT
TGAAAAATATACTACGAACGAAGAGGGCAAAGCGTTAGTCGCTGCGGGGC
CTCAGCTTTCAAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy