Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR971 IGR974 IGR973 IGR969 IGR975 IGR972 IGR970 ispF, - HD1328 ispD, - HD1329 lapB, - HD1332 sucB, - HD1334 sucA, - HD1336 hhdB, - HD1326 pckA,ppc, - HD1331 hhdA, - HD1327 ispF, - HD1328 ispD, - HD1329 lapB, - HD1332 sucB, - HD1334 sucA, - HD1336 hhdB, - HD1326 pckA,ppc, - HD1331 hhdA, - HD1327 ispF, - HD1328 ispD, - HD1329 lapB, - HD1332 sucB, - HD1334 sucA, - HD1336 HD1330 HD1330 hhdB, - HD1326 pckA,ppc, - HD1331 hhdA, - HD1327
* Calculated from Protein Sequence

Gene ID: HD1329

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ispD  

Definition:
4-diphosphocytidyl-2C-methyl-D-erthyritol synthase (MEP cytidyltransferase) (MCT)

Gene Start:
1087746

Gene Stop:
1087036

Gene Length:
711

Molecular Weight*:
26111

pI*:
7.10

Net Charge*:
0.31

EC:
2.7.7.60  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Other  

Pathway: pathway table
Sterol biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to hypothetical protein from H. influenzae (2811032), E. coli (2833415), Neisseria meningitidis (7380354), among others.

Positions 27 to 230 are 57% (E value 2e-61) similar to sp|O05029|YGBP_HAEIN hypothetical protein HI0672 between positions 17 and 220 in Haemophilus influenzae Rd. Positions 27 to 236 are 49% (E value 6e-54) similar to sp|Q46893|YGBP_ECOLI hypothetical protein b2747 between positions 20 and 233 in Escherichia coli.

HD1329 is similar to sugar nucleotide phosphorylase from C. pneumoniae (CPn0579), C. trachomatis (CT462, probable), and to conserved hypothetical protein from T. pallidum (TP0512). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 10 clades of COG1211
COG name: 4-diphosphocytidyl-2-methylerithritol synthase
Functional Class: I
The phylogenetic pattern of COG1211 is ---k-qvcebrhujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001228 (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) with a combined E-value of 5.8e-70.
    IPB001228A    17-49
    IPB001228B    88-100
    IPB001228C    108-117
    IPB001228D    135-147
    IPB001228E    157-181
    IPB001228F    192-223


ProDom Summary:  Protein Domain Search
Residues 27-142 are 57% similar to a (TRANSFERASE COMPLETE PROTEOME BIOSYNTHESIS) protein domain (PD000318) which is seen in ISPD_HAEIN.

Residues 145-223 are 55% similar to a (SYNTHASE MCT 2.7.7.- MEP) protein domain (PD331472) which is seen in ISPD_HAEIN.

Residues 168-230 are 50% similar to a (SYNTHASE TRANSFERASE MCT MEP) protein domain (PD006861) which is seen in ISPD_BACHD.

Residues 111-230 are 33% similar to a (MCT MEP CYTIDYLYLTRANSFERASE 2.7.7.-) protein domain (PD331519) which is seen in ISPD_CHLPN.

Residues 88-144 are 57% similar to a (SYNTHASE MCT MEP TRANSFERASE) protein domain (PD168374) which is seen in ISPD_PASMU.

Residues 82-166 are 37% similar to a (MCT MEP CYTIDYLYLTRANSFERASE 2.7.7.-) protein domain (PD392963) which is seen in ISPD_AQUAE.



Paralogs:  Local Blast Search

HD1329 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 15 to 232 (E-value = 1.2e-102) place HD1329 in the IspD family which is described as Uncharacterized protein family UPF0007 (PF01128)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LCLVINRESLMNRKIIAIIPASGIGSRMNAALPKQYLTLQGKTILEHTVA
IFLNHPQIDKIVIALSANDQHHQHISLLTSDKIQLVNGGASRAESVFNAL
QSIDEHSWALVHDAARPCLKRSDLDKLLQITDQNGAILASPVVDTLKRAE
GNKISHTEDRTTLWHALTPQFFPTALLKQALQQAFDRQQNVTDEASAMEL
AGYQPTLITGSNSNLKITRPEDLALAEFYLMHSLEK$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTGCCTCGTAATTAATAGAGAATCATTAATGAACAGAAAAATTATTGC
AATAATTCCCGCTTCAGGCATAGGTAGCAGAATGAATGCCGCCTTACCCA
AGCAATACCTCACACTGCAAGGCAAAACGATTTTAGAACATACCGTTGCC
ATCTTCTTAAATCATCCTCAAATTGACAAAATAGTTATTGCACTTTCGGC
AAACGATCAACATCACCAACACATTAGCTTATTAACTTCCGACAAAATTC
AATTAGTCAACGGCGGAGCGAGCCGAGCCGAATCCGTATTTAATGCATTA
CAAAGTATTGATGAACATAGCTGGGCATTAGTACACGACGCAGCCAGACC
TTGCCTCAAGCGCTCAGATTTAGATAAATTATTACAAATTACCGATCAAA
ACGGTGCCATTCTTGCCAGCCCCGTGGTTGACACCCTCAAACGAGCAGAA
GGGAACAAAATCAGCCACACCGAAGATCGCACAACATTATGGCACGCCCT
CACGCCACAATTTTTCCCGACGGCTTTACTCAAACAAGCGCTACAACAAG
CCTTTGACCGTCAGCAAAATGTCACAGACGAAGCTTCGGCAATGGAATTA
GCCGGTTATCAACCGACTTTAATCACAGGTAGCAATAGCAATTTAAAAAT
TACCCGCCCCGAAGATCTTGCTTTGGCAGAATTCTATTTAATGCATTCAT
TGGAGAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy