Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR964 IGR967 IGR965 IGR961 IGR966 IGR963 IGR969 IGR962 IGR968 HD1319 HD1320 ispA, - HD1322 HD1324 HD1317 sanA, - HD1316 lysU, - HD1318 hhdB, - HD1326 HD1325 hhdA, - HD1327 HD1319 HD1320 ispA, - HD1322 HD1324 HD1317 sanA, - HD1316 lysU, - HD1318 hhdB, - HD1326 HD1325 hhdA, - HD1327 HD1319 HD1320 ispA, - HD1322 xseB, - HD1323 HD1321 xseB, - HD1323 HD1321 HD1324 sanA, - HD1316 lysU, - HD1318 hhdB, - HD1326 HD1325 hhdA, - HD1327 HD1317
* Calculated from Protein Sequence

Gene ID: HD1322

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ispA  

Definition:
geranylgeranyl pyrophosphate synthase; farnesyl-diphosphate synthase

Gene Start:
1078241

Gene Stop:
1077315

Gene Length:
927

Molecular Weight*:
33755

pI*:
7.20

Net Charge*:
0.79

EC:
2.5.1.10  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Sterol biosynthesis
Terpenoid biosynthesis

Secondary Evidence:
Fujisaki,S., Hara,H., Nishimura,Y., Horiuchi,K. and Nishino,T. Cloning and nucleotide sequence of the ispA gene responsible for farnesyl diphosphate synthase activity in Escherichia coli.
J. Biochem. 108(6): 995-1000, 1990.
Medline: 91210228.

Comment:
0

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to geranyltranstransferase from H. influenzae (1170589), E. coli (124931), Synechococcus elongatus (5631297), among others.

Positions 19 to 308 are 58% (E value 3e-93) similar to sp|P45204|ISPA_HAEIN geranyltranstransferase between positions 7 and 295 in Haemophilus influenzae Rd. Positions 20 to 306 are 54% (E value 3e-78) similar to sp|P22939|ISPA_ECOLI geranyltranstransferase between positions 7 and 297 in Escherichia coli.

HD1322 is similar to geranylgeranyl pyrophosphate synthase from C. trachomatis (CT628), geranyltranstransferase from C. pneumoniae (CPn0748), and octaprenyl-diphosphate synthase/ farnesyltranstransferase from T. pallidum (TP0683). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0142
COG name: Geranylgeranyl pyrophosphate synthase
Functional Class:  H
The phylogenetic pattern of COG0142 is AmtkYQVCEBRHUJ--olinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000092 (Polyprenyl synthetase) with a combined E-value of 2e-35.
    IPB000092A    56-65
    IPB000092B    86-97
    IPB000092C    100-115
    IPB000092D    168-173
    IPB000092E    227-249


ProDom Summary:  Protein Domain Search
Residues 19-200 are 64% similar to a (SYNTHASE SYNTHETASE PYROPHOSPHATE TRANSFERASE) protein domain (PD000572) which is seen in Q9CNA1_PASMU.

Residues 149-204 are 53% similar to a (SYNTHASE PROTEOME TRANSFERASE FPP) protein domain (PD413214) which is seen in ISPA_MICLU.

Residues 213-268 are 67% similar to a (SYNTHASE SYNTHETASE TRANSFERASE DIPHOSPHATE) protein domain (PD003059) which is seen in Q9CNA1_PASMU.

Residues 214-286 are 49% similar to a (SYNTHASE PYROPHOSPHATE GERANYLGERANYL) protein domain (PD169539) which is seen in GGPP_CAPAN.



Paralogs:  Local Blast Search

HD1322 is paralogously related to HD0705 (4e-22).


Pfam Summary:  Pfam Search
Residues 45 to 304 (E-value = 4.1e-98) place HD1322 in the polyprenyl_synt family which is described as Polyprenyl synthetase (PF00348)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNKPNLQITNNMTYSLTTDLNAIQQRINHFLSNQLPQSPTEQPPLNQAMA
YAVLLGGKRIRPFLMYTTGKMLGVPLTTLDHSAAAIEAIHAYSLVHDDLP
AMDNDQLRRGKPTCHIAFDEATAILAGNALQALAFELIANAPHLTDWQKV
QQIRTLSTAAGAKGMCLGQNLDLLAENKSLNLTELEQIHRHKTGALIVAS
VLMAVNLSDHAQNNAIKQPLERYAQAIGLAFQVQDDILDVIGQTDKIGKT
VGADQQLHKSTYPKLLGLTQAKQKAQDLHQTALNALAELPFKSTALKELA
DFIIHREN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACAAGCCGAACTTGCAGATTACGAATAATATGACTTACTCACTCAC
AACCGATCTTAATGCTATCCAACAACGGATCAACCATTTCCTAAGCAACC
AACTGCCACAATCGCCAACCGAACAACCACCGCTTAATCAAGCGATGGCC
TATGCCGTATTACTAGGTGGCAAACGCATACGCCCTTTTCTAATGTACAC
CACCGGCAAAATGCTAGGCGTCCCATTAACTACACTCGACCACTCAGCGG
CTGCAATTGAAGCCATTCACGCTTACTCACTAGTACACGACGATCTCCCT
GCAATGGACAATGACCAACTACGCCGCGGCAAACCGACTTGCCACATAGC
CTTTGACGAAGCCACCGCCATCTTAGCCGGCAATGCCTTACAAGCGCTAG
CATTTGAGCTAATTGCTAACGCCCCACACCTAACCGACTGGCAAAAAGTC
CAACAAATCAGAACGCTAAGCACCGCAGCAGGCGCTAAAGGCATGTGTCT
CGGCCAAAATTTAGATCTACTCGCCGAAAATAAATCGCTCAACTTAACCG
AATTAGAACAAATTCACCGCCACAAAACCGGCGCATTAATAGTAGCCTCC
GTATTAATGGCAGTTAACTTATCTGATCACGCACAAAATAATGCAATAAA
ACAACCGCTTGAACGCTACGCACAAGCAATTGGGCTCGCCTTTCAAGTGC
AAGACGATATCCTAGACGTTATCGGCCAAACCGACAAAATCGGCAAAACA
GTCGGCGCAGATCAACAACTACACAAAAGCACCTACCCCAAATTACTTGG
GCTAACACAAGCAAAACAAAAAGCACAAGACTTACACCAAACAGCACTCA
ACGCACTCGCAGAACTGCCGTTTAAAAGCACTGCATTAAAAGAGTTAGCC
GACTTTATTATTCATCGCGAAAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy