Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR964 IGR967 IGR965 IGR961 IGR966 IGR963 IGR960 IGR962 IGR959 IGR968 HD1314 HD1315 HD1319 HD1320 ispA, - HD1322 HD1324 HD1317 sanA, - HD1316 lysU, - HD1318 hhdB, - HD1326 HD1325 HD1314 HD1315 HD1319 HD1320 ispA, - HD1322 HD1324 HD1317 sanA, - HD1316 lysU, - HD1318 hhdB, - HD1326 HD1325 HD1315 HD1319 HD1320 ispA, - HD1322 xseB, - HD1323 HD1321 xseB, - HD1323 HD1321 HD1314 HD1324 HD1317 sanA, - HD1316 lysU, - HD1318 hhdB, - HD1326 HD1325
* Calculated from Protein Sequence

Gene ID: HD1321

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
probable integral membrane protein

Gene Start:
1077293

Gene Stop:
1076682

Gene Length:
612

Molecular Weight*:
22630

pI*:
9.30

Net Charge*:
3.85

EC:
 

Functional Class:
Unassigned  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Three significant hits using gapped BLAST to hypothetical protein from Neisseria meningitidis (7225461, 7378798, 7225462).

Positions 1 to 199 are 51% (E value 7e-52) similar to gb|AAF40693.1 hypothetical protein between positions 1 and 202 in Neisseria meningitidis.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0477
COG name: Permeases
Functional Class: G,E,R
The phylogenetic pattern of COG0477 is AMTKYQVCEBRHUJGPo-INX
Number of proteins in this genome belonging to this COG is 12

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-199 are 51% similar to a (PROTEOME COMPLETE MEMBRANE INTEGRAL) protein domain (PD309202) which is seen in Q9JQN8_NEIMB.



Paralogs:  Local Blast Search
HD1321 is paralogously related to HD1320 (3e-08).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTHYSTKTIKSVFFLSGMAALIYQIAWQRLLFTAFGVDLESITIIISVFM
VGLGIGAYYGGRIADRFPTRIIQFFALTEMGIGTFGLASPFLIEFVKHTF
LHSTLPTIAFANFLLLLFPTFLMGCTLPLLTQHLNQYIDNIGDNIGWLYF
TNTLGAATACLLTGFALFNYLTLTQVIYLAAAINYIVAIAIFIKYRNKGN
KND$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGCATTACAGTACCAAAACGATAAAAAGTGTATTCTTTTTATCTGG
AATGGCTGCATTAATTTATCAAATCGCTTGGCAAAGGTTATTATTTACCG
CATTTGGCGTTGATTTAGAATCCATTACCATCATTATCTCTGTTTTTATG
GTAGGGCTTGGCATAGGTGCTTACTATGGCGGGCGCATTGCCGATCGCTT
TCCCACGCGGATTATTCAATTTTTTGCCTTAACTGAAATGGGCATTGGCA
CTTTTGGTTTAGCAAGCCCATTCTTAATTGAATTTGTTAAACACACATTC
TTACATTCAACATTACCCACTATTGCTTTCGCTAATTTCCTATTACTGCT
ATTCCCCACTTTTCTAATGGGGTGCACCTTGCCACTCTTAACTCAACACC
TAAATCAATATATAGATAACATTGGCGACAATATCGGCTGGCTATATTTT
ACCAACACCTTAGGTGCCGCGACCGCTTGCCTACTCACAGGCTTCGCATT
ATTTAATTACCTAACATTAACCCAAGTAATTTACCTCGCTGCGGCCATCA
ATTACATCGTCGCCATAGCAATTTTTATTAAATATCGCAATAAGGGCAAT
AAAAATGACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy