Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR964 IGR967 IGR965 IGR957 IGR961 IGR966 IGR958 IGR963 IGR960 IGR962 IGR959 IGR968 HD1314 HD1315 flp2, - HD1311 flp1, - HD1312 HD1319 HD1320 ispA, - HD1322 HD1324 HD1313 HD1317 sanA, - HD1316 lysU, - HD1318 hhdB, - HD1326 HD1325 HD1314 HD1315 flp2, - HD1311 flp1, - HD1312 HD1319 HD1320 ispA, - HD1322 HD1324 HD1313 HD1317 sanA, - HD1316 lysU, - HD1318 hhdB, - HD1326 HD1325 HD1315 flp1, - HD1312 HD1319 HD1320 ispA, - HD1322 xseB, - HD1323 HD1321 xseB, - HD1323 HD1321 flp2, - HD1311 HD1314 HD1324 HD1313 HD1317 sanA, - HD1316 lysU, - HD1318 hhdB, - HD1326 HD1325
* Calculated from Protein Sequence

Gene ID: HD1320

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
possible integral membrane protein

Gene Start:
1076689

Gene Stop:
1075865

Gene Length:
825

Molecular Weight*:
30382

pI*:
8.30

Net Charge*:
5.58

EC:
 

Functional Class:
Unassigned  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Two significant hits using gapped BLAST to hypothetical protein from Neisseria meningitidis (7225462, 7378798), among others.

Positions 20 to 271 are 42% (E value 4e-51) similar to gb|AAF40694.1| (AE002381) hypothetical protein between positions 14 and 263 in Neisseria meningitidis MC58. Positions 20 to 271 are 42% (E value 4e-51) similar to emb|CAB83340.1| (AL162752) putative integral membrane protein between positions 25 and 274 in Neisseria meningitidis.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 20-271 are 42% similar to a (PROTEOME COMPLETE MEMBRANE NMB0240) protein domain (PD361077) which is seen in Q9K1C4_NEIMB.



Paralogs:  Local Blast Search

HD1320 is paralogously related to HD1321 (4e-08).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTKKAILLSFLGGFLSLSLEVIWIRLLGFQTFSLPQAFSFTLALFLLGIA
FSSFIGKKVCQQGDASINYIGRIFFIAALFDCLAIGLISTTSNSFTNLVY
SIFSIFCCALLRGIVFPIVHHLGSEHKKTGAAISNVYFANVLGCTIAPIF
IGFYLLDQFTTQQTYLIVISITLIIACFCLTKRVFKAINALFAISVVFAT
ALLPEKMISTLANEEDMQLETLIENKHGIIQVYLDKNQDHLVYGSNVYDG
QLNVNLNHNSNGIHRAYLLPAHRK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTAAAAAAGCAATATTATTATCATTTTTAGGCGGTTTTCTAAGTTT
AAGCCTAGAAGTTATTTGGATTCGCTTATTAGGTTTTCAAACATTTAGTT
TACCGCAAGCCTTTTCATTTACCTTAGCCCTATTTTTGCTCGGTATCGCC
TTTAGCTCATTCATCGGCAAAAAAGTATGCCAACAAGGCGACGCTAGCAT
TAATTATATCGGACGTATTTTCTTCATCGCCGCGTTATTTGACTGCCTCG
CTATTGGCTTAATCAGCACAACGAGCAATTCATTCACTAATCTAGTATAT
TCCATTTTCAGTATTTTTTGCTGTGCGCTACTACGCGGTATTGTTTTCCC
AATTGTCCACCATTTAGGTTCTGAGCATAAAAAAACAGGCGCAGCGATTT
CAAACGTCTATTTTGCCAACGTATTGGGATGCACTATTGCCCCCATTTTC
ATCGGCTTCTATTTACTCGACCAATTTACTACTCAACAAACCTATTTAAT
CGTAATCAGTATCACACTGATTATCGCTTGTTTTTGCCTGACCAAGCGCG
TATTCAAAGCAATCAACGCCCTATTTGCCATAAGTGTCGTATTTGCCACC
GCATTATTGCCTGAAAAAATGATCAGCACGCTAGCAAATGAAGAAGATAT
GCAACTAGAAACATTGATTGAAAATAAACACGGCATTATTCAAGTCTATC
TTGATAAAAATCAAGACCATCTTGTTTATGGCAGCAATGTTTATGATGGA
CAACTAAATGTCAATTTAAACCACAACAGCAACGGCATTCATCGTGCTTA
TTTACTACCGGCGCACCGAAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy