Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR964 IGR967 IGR956 IGR965 IGR957 IGR961 IGR966 IGR958 IGR963 IGR955 IGR960 IGR962 IGR959 HD1314 HD1315 flp2, - HD1311 flp1, - HD1312 flp3, - HD1310 HD1309 HD1319 HD1320 ispA, - HD1322 HD1324 HD1313 HD1317 sanA, - HD1316 lysU, - HD1318 HD1325 HD1314 HD1315 flp2, - HD1311 flp1, - HD1312 flp3, - HD1310 HD1309 HD1319 HD1320 ispA, - HD1322 HD1324 HD1313 HD1317 sanA, - HD1316 lysU, - HD1318 HD1325 HD1315 flp1, - HD1312 HD1309 HD1319 HD1320 ispA, - HD1322 xseB, - HD1323 HD1321 xseB, - HD1323 HD1321 HD1314 flp3, - HD1310 flp2, - HD1311 HD1324 HD1313 HD1317 sanA, - HD1316 lysU, - HD1318 HD1325
* Calculated from Protein Sequence

Gene ID: HD1319

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
possible integral membrane protein

Gene Start:
1075853

Gene Stop:
1075188

Gene Length:
666

Molecular Weight*:
25043

pI*:
9.50

Net Charge*:
3.43

EC:
 

Functional Class:
Unassigned  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to different kinds of proteins. Residues 1-214 are 45% similar to a hypothetical from Neisseria meningitidis (15676164|) and residues 1-113 are 29% similar to spermidine synthase from Corynebacterium efficiens (25029103|).

Positions 1 to 214 are 45% (E value 2e-49) similar to gb|AAF40694.1| (AE002381) hypothetical protein between positions 273 and 481 in Neisseria meningitidis MC58. Positions 1 to 214 are 45% (E value 2e-49) similar to emb|CAB83340.1| (AL162752) putative integral membrane protein between positions 284 and 492 in Neisseria meningitidis.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0421
COG name: Spermidine synthase
Functional Class: E
The phylogenetic pattern of COG0421 is am-kYQv-ebr-uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-214 are 45% similar to a (PROTEOME COMPLETE MEMBRANE NMB0240) protein domain (PD361077) which is seen in Q9K1C4_NEIMB.



Paralogs:  Local Blast Search
HD1319 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VVGLSTGSWVKVLTSMPNLESITVVELNPAYVQLASSYPAMADLLKDNRV
NIITDDGRRWLNKNPDQKFDLILMNTTFHWRNYATNLLSQQFLTVTKQHL
TDNGFIYFNTTDALDAYKTSQAVFPHVYAYENMSLASLKPIAVPTTPEVH
RALANLKWHDGRHIFNSPAEIAEGTARIVNTPLIPYKDIDFSPLKRPAKI
ITDTNMITEYKYGRLNTVINK$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGTTGGCTTAAGCACCGGCTCTTGGGTAAAAGTATTAACCAGTATGCC
TAATCTAGAATCAATCACCGTGGTTGAACTAAACCCAGCCTATGTACAAC
TTGCCTCATCTTATCCGGCAATGGCAGATCTACTAAAAGATAACCGAGTA
AACATCATTACTGACGATGGCCGCCGTTGGTTAAACAAAAATCCAGATCA
AAAATTTGATCTCATTTTAATGAACACCACTTTCCATTGGCGCAATTACG
CAACCAATTTACTCAGCCAACAATTTTTAACAGTAACTAAACAGCATTTA
ACCGACAATGGCTTCATCTACTTTAATACGACTGACGCCTTAGATGCTTA
TAAAACATCACAAGCCGTATTCCCACACGTTTATGCATATGAAAATATGT
CCTTAGCCTCATTAAAACCGATCGCGGTGCCGACAACGCCAGAAGTTCAT
CGAGCATTAGCTAATCTAAAATGGCACGACGGGCGTCATATTTTCAACTC
CCCAGCAGAAATAGCCGAAGGAACCGCTAGAATTGTCAATACTCCATTAA
TCCCCTATAAAGATATTGATTTTTCACCCTTAAAACGCCCTGCTAAAATA
ATTACAGATACGAATATGATCACCGAATATAAATATGGCAGGCTAAACAC
AGTAATTAATAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy