Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR964 IGR967 IGR956 IGR965 IGR957 IGR954 IGR961 IGR966 IGR958 IGR963 IGR955 IGR960 IGR962 IGR959 HD1314 HD1315 flp2, - HD1311 flp1, - HD1312 flp3, - HD1310 HD1309 HD1319 HD1320 rcpC, - HD1308 ispA, - HD1322 rcpA, - HD1307 HD1324 HD1313 HD1317 sanA, - HD1316 lysU, - HD1318 HD1325 HD1314 HD1315 flp2, - HD1311 flp1, - HD1312 flp3, - HD1310 HD1309 HD1319 HD1320 rcpC, - HD1308 ispA, - HD1322 rcpA, - HD1307 HD1324 HD1313 HD1317 sanA, - HD1316 lysU, - HD1318 HD1325 HD1315 flp1, - HD1312 HD1309 HD1319 HD1320 ispA, - HD1322 rcpA, - HD1307 xseB, - HD1323 HD1321 xseB, - HD1323 HD1321 HD1314 flp3, - HD1310 rcpC, - HD1308 flp2, - HD1311 HD1313 HD1317 sanA, - HD1316 lysU, - HD1318 HD1325 HD1324
* Calculated from Protein Sequence

Gene ID: HD1318

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lysU  

Definition:
lysyl-tRNA synthetase

Gene Start:
1073626

Gene Stop:
1075122

Gene Length:
1497

Molecular Weight*:
56211

pI*:
4.90

Net Charge*:
-18.62

EC:
6.1.1.6  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Lysine biosynthesis

Secondary Evidence:
Leveque,F., Plateau,P., Dessen,P. and Blanquet,S.
Homology of lysS and lysU, the two Escherichia coli genes encoding distinct lysyl-tRNA synthetase species.
Nucleic Acids Res. 18(2): 305-312.1990.
Medline: 90221811.

Commans,S., Plateau,P., Blanquet,S. and Dardel,F.
Solution structure of the anticodon-binding domain of Escherichia coli lysyl-tRNA synthetase and studies of its interaction with tRNA(Lys).
J. Mol. Biol. 253(1): 100-113. 1995.
Medline: 96028214.

Clark,R.L. and Neidhardt,F.C.
Roles of the two lysyl-tRNA synthetases of Escherichia coli: analysis of nucleotide sequences and mutant behavior.
J. Bacteriol. 172(6): 3237-3243.1990
Medline: 90264318.

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to lysyl-tRNA synthetase protein sequences,e.g.residues 1-498 are 78% similar to lysyl-tRNA synthetase in Haemophilus influenzae strain Rd KW20 (1174526).

Residues 7-496 are 68% similar to lysyl-tRNA synthetase in Escherichia coli K12 (135135|).

COGS Summary:  COGS Search
BeTs to 11 clades of COG1190
COG name: Lysyl-tRNA synthetases
Functional Class: J
The phylogenetic pattern of COG1190 is ----YQvcEbRHujgp-lin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002106 (Aminoacyl-transfer RNA synthetases class-II) with a combined E-value of 2.3e-10.
    IPB002106A    191-203
    IPB002106B    472-486


ProDom Summary:  Protein Domain Search
Residues 16-156 are 65% similar to a (SYNTHETASE LIGASE LYSYL-TRNA AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD003714) which is seen in SYK_PASMU.

Residues 264-300 are 91% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA ATP-BINDING) protein domain (PD000871) which is seen in SYK_PASMU.

Residues 452-498 are 89% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000848) which is seen in SYK_HAEIN.

Residues 307-407 are 73% similar to a (SYNTHETASE LIGASE LYSYL-TRNA) protein domain (PD403149) which is seen in SYK_HAEIN.

Residues 309-426 are 84% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD110938) which is seen in SYK_PASMU.

Residues 265-409 are 27% similar to a (LIGASE SYNTHETASE ATP-BINDING LYSYL-TRNA) protein domain (PD206465) which is seen in SYK1_MYCTU.

Residues 188-407 are 31% similar to a (SYNTHETASE LIGASE LYSYL-TRNA) protein domain (PD190229) which is seen in SYK3_ECOLI.

Residues 204-263 are 96% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA LYSYL-TRNA ATP-BINDING) protein domain (PD318428) which is seen in SYK_HAEIN.

Residues 408-448 are 92% similar to a (SYNTHETASE LIGASE LYSYL-TRNA) protein domain (PD334399) which is seen in SYK_HAEIN.

Residues 452-492 are 73% similar to a (SYNTHETASE LIGASE LYSYL-TRNA) protein domain (PD186099) which is seen in SYK_BACSU.

Residues 158-203 are 78% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD002022) which is seen in SYK_PASMU.



Paralogs:  Local Blast Search


HD1318 is paralogously related to HD0029 (1e-40), HD0599 (9e-15) and HD1411 (1e-11).


Pfam Summary:  Pfam Search
Residues 62 to 140 (E-value = 6.6e-20) place HD1318 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)
Residues 156 to 497 (E-value = 4.7e-196) place HD1318 in the tRNA-synt_2 family which is described as tRNA synthetases class II (D, K and N) (PF00152)

PDB Hit:
pdb|1BBU|A Chain A, Lysyl-Trna Synthetase (Lyss) Complexed With... 684 0.0
pdb|1E1O|A Chain A, Lysyl-Trna Synthetase (Lysu) Hexagonal For,... 682 0.0
pdb|1KRS| Mol_id: 1; Molecule: Lysyl-Trna Synthetase (Produc... 127 4e-030

Gene Protein Sequence:
MSEEQELDLNGEMLARREKLAKIRAMGNPFPNRFRRDAYAYALQAEYAEM
AGDALKDADVQVKVVGRIMLKRVMGKASFFTIQDVSGQIQLYVARDNLAE
GVYVDNVGLWDLGDIVGVCGTLFKTKTGELTVRCADVELLTKSLRPLPNK
HQGLVDQEMRYRQRYLDLIANEQSRRTFVIRSQVVSGIRQFFLERGFMEV
ETPMLQVIPGGAAAKPFVTHHNALDVDMYLRIAPELYLKRLVVGGFERVF
ELNRNFRNEGVSVRHNPEFTMIEYYQAYADYHDLMDNTEQLLRKLALDIL
GTTAVPYGEYQFDFGQPFERITMHDAIVKYGNGIAREDLDDIEKAVEIAK
KLGIEVQKSWGLGAVVNAIFEEVAEHQLIQPTFLMAHPAEISPLARRNDE
NPEVTDRFELFIGGREIGNGFSELNDAEDQAARFDAQVAAKDAGDDEAMF
KDDDFVVALEHGLPPTAGEGLGIDRLVMIFANAPSIRDVILFPAMRHK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTGAAGAACAAGAATTAGATCTTAACGGCGAGATGTTAGCGCGCCG
TGAGAAGTTAGCCAAAATTCGTGCGATGGGGAATCCGTTTCCGAACCGTT
TTCGTCGTGATGCTTATGCTTATGCGTTGCAGGCTGAGTATGCGGAAATG
GCAGGAGATGCATTAAAAGATGCGGATGTGCAGGTGAAGGTTGTTGGCCG
TATTATGCTAAAAAGGGTGATGGGTAAGGCATCTTTCTTTACTATTCAAG
ATGTTAGCGGTCAGATTCAGCTTTATGTTGCACGAGATAATTTAGCCGAG
GGGGTTTATGTAGATAATGTCGGTTTGTGGGATTTAGGCGATATTGTTGG
CGTGTGTGGTACTTTATTTAAAACTAAAACCGGTGAGTTGACGGTTCGTT
GTGCGGACGTTGAGTTGTTGACGAAGTCATTGCGGCCGTTGCCAAATAAA
CACCAAGGATTGGTTGATCAAGAAATGCGTTATCGTCAGCGTTATTTGGA
TTTAATTGCAAATGAGCAGTCGCGCCGTACTTTTGTGATCCGTTCGCAAG
TGGTGTCGGGCATTCGTCAATTCTTTTTAGAACGAGGCTTTATGGAAGTG
GAAACGCCGATGTTGCAGGTGATTCCGGGCGGTGCGGCGGCTAAGCCGTT
TGTAACGCATCATAATGCGTTGGACGTGGATATGTATTTGCGTATTGCAC
CCGAGCTTTATTTAAAGCGGTTAGTGGTGGGCGGTTTTGAGCGGGTGTTT
GAGTTGAACCGTAATTTCCGTAATGAGGGCGTTTCGGTGCGCCATAATCC
AGAATTTACGATGATTGAATATTATCAAGCCTATGCGGATTATCACGATT
TAATGGATAATACGGAGCAGTTGTTGCGTAAGTTGGCGTTGGATATTCTT
GGCACAACGGCGGTGCCTTATGGTGAATATCAATTTGATTTTGGTCAGCC
GTTTGAGCGGATCACGATGCACGATGCGATTGTTAAATATGGCAATGGTA
TTGCACGAGAAGATTTAGATGATATTGAGAAAGCGGTCGAAATTGCTAAA
AAATTAGGCATTGAGGTGCAGAAATCGTGGGGCTTGGGCGCTGTGGTTAA
TGCTATTTTTGAGGAAGTGGCAGAGCATCAATTGATTCAGCCGACTTTCT
TAATGGCGCACCCTGCGGAAATTTCACCGCTTGCTCGCCGTAATGATGAG
AATCCTGAAGTAACCGATCGGTTTGAGCTGTTTATTGGCGGGCGTGAGAT
CGGTAATGGTTTTTCTGAGTTGAATGATGCTGAAGATCAAGCGGCACGTT
TTGATGCTCAAGTGGCGGCTAAAGATGCCGGCGATGATGAGGCGATGTTT
AAAGATGATGATTTTGTTGTGGCGTTAGAGCATGGCTTGCCACCCACTGC
GGGCGAGGGGTTAGGCATCGATCGTTTAGTTATGATTTTTGCCAATGCGC
CATCTATTCGTGATGTGATTTTGTTCCCTGCAATGCGCCATAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy