Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR942 IGR940 IGR948 IGR947 IGR946 IGR943 IGR941 IGR945 IGR944 HD1290 HD1288 mreD, - HD1294 yohK, - HD1289 znuB, - HD1297 gapB,gapA, - HD1291 mreB, - HD1292 mreC, - HD1293 HD1296 yoaA, - HD1287 uvrA, - HD1286 HD1290 HD1288 mreD, - HD1294 yohK, - HD1289 znuB, - HD1297 gapB,gapA, - HD1291 mreB, - HD1292 mreC, - HD1293 HD1296 yoaA, - HD1287 uvrA, - HD1286 HD1290 mreD, - HD1294 yohK, - HD1289 znuB, - HD1297 gapB,gapA, - HD1291 mreB, - HD1292 mreC, - HD1293 HD1296 yoaA, - HD1287 uvrA, - HD1286 HD1288
* Calculated from Protein Sequence

Gene ID: HD1291

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
gapB  gapA  

Definition:
glyceraldehyde 3-phosphate dehydrogenase

Gene Start:
1053688

Gene Stop:
1054692

Gene Length:
1005

Molecular Weight*:
35776

pI*:
6.50

Net Charge*:
-1.69

EC:
1.2.1.12  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
D-Arginine and D-ornithine metabolism
Glycolysis / Gluconeogenesis

Secondary Evidence:
Branlant,G. and Branlant,C. 1985. Nucleotide sequence of the Escherichia coli gap gene. Different evolutionary behavior of the NAD+-binding domain and of the catalytic domain of D-glyceraldehyde-3-phosphate dehydrogenase. Eur. J. Biochem. 150(1): 61-66. Medline: 85257641. Nelson,K., Whittam,T.S. and Selander,R.K. 1991. Nucleotide polymorphism and evolution in the glyceraldehyde-3-phosphate dehydrogenase gene (gapA) in natural populations of Salmonella and Escherichia coli. Proc. Natl. Acad. Sci. U.S.A. 88(15): 6667-6671. Medline: 91319745.

Comment:


Blast Summary:  PSI-Blast Search
Positions 5 to 338 are 79% (E value 1e-150) similar to sp|P44304|G3P_HAEIN (1169791) glyceraldehyde 3-phosphate dehydrogenase between positions 1 and 339 in Haemophilus influenzae Rd. Positions 24 to 333 are 80% (E value e-143) similar to sp|P06977|G3P1_ECOLI (729550) glyceraldehyde 3-phosphate dehydrogenase between positions 20 and 329 in E. coli. Positions 24 to 332 are 75% (E value e-134) similar to sp|Q01558|G3PC_LEIME (232117) glyceraldehyde 3-phosphate dehydrogenase between positions 19 and 327 in Leishmania mexicana.

HD1291 is similar to glyceraldehyde 3-phosphate dehydrogenase from C. pneumoniae (CPn0624), C. trachomatis (CT505), T. pallidum (TP0844), M. pneumoniae (MP0411), and M. genitalium (MG301). No similarities to U. urealyticum.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0057
COG name: Glyceraldehyde-3-phosphate dehydrogenase
Functional Class: G
The phylogenetic pattern of COG0057 is amtkYqvCEBrhUJgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000173 (Glyceraldehyde 3-phosphate dehydrogenase) with a combined E-value of 9.1e-158.
    IPB000173A    4-15
    IPB000173B    89-125
    IPB000173C    144-178
    IPB000173D    182-235
    IPB000173E    249-302
    IPB000173F    305-325


ProDom Summary:  Protein Domain Search
Residues 41-172 are 92% similar to a (DEHYDROGENASE OXIDOREDUCTASE NAD GLYCOLYSIS 3-PHOSPHATE) protein domain (PD000250) which is seen in Q9CMB0_PASMU.

Residues 187-312 are 83% similar to a (DEHYDROGENASE OXIDOREDUCTASE NAD GLYCOLYSIS) protein domain (PD000244) which is seen in G3P1_ECOLI.



Paralogs:  Local Blast Search
HD1291 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 150 (E-value = 2.1e-94) place HD1291 in the Gp_dh_N family which is described as Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain (PF00044)
Residues 151 to 312 (E-value = 5.5e-118) place HD1291 in the Gp_dh_C family which is described as Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain (PF02800)

PDB Hit:
pdb|1DC3|A Chain A, Structural Analysis Of Glyceraldehyde 3-Pho... 508 5e-145
pdb|1GAE|O Chain O, Mol_id: 1; Molecule: D-Glyceraldehyde-3-Pho... 505 3e-144
pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Pho... 492 2e-140

Gene Protein Sequence:
MAIKIGINGFGRIGRIVFRAAQLRDDIEVVGINDLIDVDYMAYMLKYDST
HGRFDGTVEVKDGQLVVNGKTIRVTSERDPANLKWDEIGVNIAVEATGLF
LTDETARKHITAGAKKVVLTGPSKDATPMFVNGVNFDTYAGQDIVSNASC
TTNCLAPLAKVIHNKFGIKEGLMTTVHATTATQKTVDGPSAKDWRGGRGA
AQNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTTNVSVVDLTVNLEKA
ASYQEICAEIKRASENEMKGVLGYTEDAVVSTDFNGATETSVFDAAAGIA
LTDTFVKLVSWYDNETGYSHKVLDLVAHVYNYRG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTATTAAAATTGGTATTAACGGCTTTGGTCGTATTGGTCGCATCGT
TTTCCGTGCAGCACAATTACGTGATGATATCGAAGTAGTCGGTATTAACG
ATTTAATTGATGTTGATTACATGGCGTACATGTTAAAATACGATTCAACG
CATGGTCGTTTTGACGGTACAGTTGAAGTAAAAGATGGTCAATTAGTAGT
AAATGGTAAAACGATTCGTGTTACATCAGAACGCGATCCTGCGAACTTAA
AATGGGATGAAATCGGCGTTAATATTGCGGTTGAAGCAACCGGTTTATTC
TTAACTGATGAAACAGCACGTAAGCACATTACTGCTGGTGCTAAAAAAGT
AGTATTAACAGGCCCATCTAAAGATGCCACACCTATGTTTGTGAATGGTG
TAAACTTTGATACGTATGCCGGTCAAGACATCGTTTCAAATGCCTCTTGT
ACGACTAACTGCCTAGCGCCATTAGCAAAAGTTATCCATAATAAATTTGG
TATTAAAGAAGGCTTAATGACAACCGTCCACGCCACTACAGCAACGCAAA
AAACAGTAGATGGCCCATCAGCGAAAGACTGGCGTGGTGGACGTGGTGCA
GCGCAAAATATTATCCCGTCCTCAACTGGCGCAGCTAAAGCAGTAGGTAA
AGTATTACCAGCATTAAATGGTAAATTAACCGGTATGGCATTCCGTGTTC
CAACAACTAACGTATCCGTGGTTGATTTAACCGTTAATTTAGAAAAAGCG
GCAAGCTATCAAGAAATTTGTGCGGAAATTAAACGTGCATCAGAAAACGA
AATGAAAGGCGTATTGGGCTATACCGAAGATGCTGTTGTTTCAACCGACT
TTAATGGTGCAACAGAAACGTCAGTATTTGATGCAGCGGCAGGTATCGCA
TTAACCGATACCTTTGTTAAATTAGTTTCTTGGTACGACAACGAAACCGG
TTACTCTCACAAAGTATTAGATTTAGTTGCACACGTTTACAACTATAGAG
GCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy