Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-3 IGR937 IGR936 IGR933 IGR938 IGR939 IGR934 ssb, - HD1285 fhs, - HD1282 HD1283 secG, - HD1277 HD1284 nisP, - HD1278 nisP, - HD1280 topB, - HD1276 uvrA, - HD1286 ssb, - HD1285 fhs, - HD1282 HD1283 secG, - HD1277 HD1284 nisP, - HD1278 nisP, - HD1280 topB, - HD1276 uvrA, - HD1286 ssb, - HD1285 fhs, - HD1282 HD1284 nisP, - HD1278 nisP, - HD1280 topB, - HD1276 uvrA, - HD1286 HD1283 secG, - HD1277
* Calculated from Protein Sequence

Gene ID: HD1282

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
fhs  

Definition:
formate-tetrahydrofolate ligase

Gene Start:
1045623

Gene Stop:
1043953

Gene Length:
1671

Molecular Weight*:
59157

pI*:
7.10

Net Charge*:
0.54

EC:
6.3.4.3  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Folate biosynthesis
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate

Secondary Evidence:
Whitehead,T.R. and Rabinowitz,J.C.
Nucleotide sequence of the Clostridium acidiurici ("Clostridium
acidi-urici") gene for 10-formyltetrahydrofolate synthetase shows
extensive amino acid homology with the trifunctional enzyme
C1-tetrahydrofolate synthase from Saccharomyces cerevisiae
J. Bacteriol. 170 (7), 3255-3261 (1988)
MEDLINE: 88257049

Leaphart AB, Lovell CR.
Recovery and analysis of formyltetrahydrofolate synthetase gene sequences from natural populations of acetogenic bacteria.
Appl Environ Microbiol. 2001 Mar;67(3):1392-5.
PMID: 11229939

Crowley PJ, Gutierrez JA, Hillman JD, Bleiweis AS.
Genetic and physiologic analysis of a formyl-tetrahydrofolate synthetase mutant of Streptococcus mutans.
J Bacteriol. 1997 Mar;179(5):1563-72.
PMID: 9045814


Comment:


Blast Summary:  PSI-Blast Search
Positions 2 to 556 are 73% (E value 0.0) similar to emb|CAB83907.1| (AL162753) (7379352) putative formate-tetrahydrofolate ligase between positions 4 and 558 in Neisseria meningitidis. Positions 2 to 556 are 73% (E value 0.0) similar to gb|AAF42174.1| (AE002533) (7227094) formate-tetrahydrofolate ligase between positions 4 and 558 in Neisseria meningitidis MC58. Positions 1 to 556 are 57% (E value e-177) similar to sp|P13419|FTHS_CLOAC (120562) formate-tetrahydrofolate ligase between positions 1 and 556 in Clostridium acidi-urici.

HD1282 is similar to formate-tetrahydrofolate ligase from U. urealyticum (UU221). No similarities to C. trachomatis, C. pneumoniae, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** IPB000559 (Formate-tetrahydrofolate ligase) with a combined E-value of 2.3e-257.
    IPB000559A    9-53
    IPB000559B    53-81
    IPB000559C    92-141
    IPB000559D    142-182
    IPB000559E    183-224
    IPB000559F    241-291
    IPB000559G    292-340
    IPB000559H    348-388
    IPB000559I    434-458
    IPB000559J    478-510
    IPB000559K    511-546
    IPB000559H    347-387


ProDom Summary:  Protein Domain Search
Residues 16-201 are 68% similar to a (LIGASE SYNTHASE SYNTHETASE) protein domain (PD003089) which is seen in Q9JVY8_NEIMA.

Residues 475-535 are 80% similar to a (LIGASE SYNTHETASE SYNTHASE) protein domain (PD186204) which is seen in Q9JXY2_NEIMB.

Residues 202-471 are 76% similar to a (LIGASE SYNTHASE SYNTHETASE) protein domain (PD341571) which is seen in Q9JVY8_NEIMA.

Residues 153-200 are 58% similar to a (SYNTHASE SYNTHETASE) protein domain (PD371392) which is seen in FTHS_SPIOL.



Paralogs:  Local Blast Search
HD1282 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKSDVEIAQSATMQHINHIAEKLGLTVDQIEQYGKYKAKINPADAFKLPA
KNGKLILVTAINPTPAGEGKTTVTIGLTDALNHIGKQAVVAAREPSLGPV
FGVKGGAAGGGYAQVLPMEDINLHFTGDFHAITSANNLLAALLDNHIYQG
NALNIDPKRILWRRVIDMNDRQLRNILGGLGNTTDGVIRPDGFDITVASE
VMAIFCLAKDLADLKTRLGNILVAYTKDKQPVYAKDLNAQGAMAALLKDA
IKPNLVQTMAGSPAFIHGGPFANIAHGCNSVIATRLALHLGDYAVTEAGF
GADLGAEKFCDIKCRLAELKPDVAVIVATVRALKYNGGVEKANLAEENLE
ALTEGLPNLLKHIANLKNVLGLPVVVALNRFVSDSDAELALIQTACAKQG
VEVSLTEVWARSAVGGVDLAHKVLKAIDEQQNNFQFAYDVNDRIQHKITA
IAQKIYGATDVNFSAEALAEIKNLEKLALDKLPICMAKTQYSLSDSAKLL
GCPTGFNITVRSITVSAGAGFIVAICGSIMRMPGLPKNPATNRIDVDENG
VISGLF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAGCGATGTAGAAATTGCACAATCTGCAACTATGCAACACATTAA
TCATATAGCCGAAAAACTAGGTTTAACGGTAGATCAAATCGAGCAATATG
GTAAATATAAAGCCAAAATTAATCCTGCCGATGCCTTTAAATTGCCCGCT
AAAAACGGTAAATTAATTTTAGTTACTGCGATTAATCCAACTCCGGCAGG
CGAAGGAAAAACAACCGTAACAATTGGATTAACTGATGCGTTAAATCATA
TTGGTAAGCAAGCGGTAGTTGCTGCTCGTGAACCATCTTTAGGCCCCGTG
TTCGGAGTAAAAGGCGGTGCTGCGGGTGGGGGGTATGCACAAGTATTGCC
AATGGAAGATATTAATTTGCATTTTACCGGTGATTTTCATGCAATTACGA
GTGCTAATAATTTACTCGCGGCGTTATTAGATAACCATATTTATCAAGGT
AATGCATTAAACATTGATCCAAAACGGATTCTATGGCGACGCGTAATTGA
TATGAATGATCGTCAATTACGTAATATTCTAGGCGGTTTAGGCAACACTA
CCGATGGTGTTATTCGCCCAGATGGTTTTGATATTACCGTTGCGTCTGAA
GTAATGGCGATTTTCTGCTTAGCCAAAGATTTAGCGGATTTAAAAACACG
GTTAGGCAATATTTTAGTTGCATATACCAAAGATAAACAACCGGTTTACG
CTAAAGATTTAAATGCACAAGGTGCAATGGCCGCGCTGTTAAAAGATGCA
ATCAAACCAAACTTAGTACAAACAATGGCAGGCAGTCCTGCATTTATTCA
TGGTGGCCCTTTTGCCAATATTGCCCATGGTTGTAATTCGGTTATCGCCA
CCCGTTTAGCATTACATTTAGGTGATTATGCCGTTACAGAAGCGGGCTTT
GGCGCTGATCTTGGTGCAGAAAAATTCTGTGATATTAAATGCCGTTTAGC
AGAATTAAAACCCGATGTTGCAGTCATTGTGGCTACTGTACGTGCATTAA
AATATAACGGTGGCGTAGAAAAAGCTAATTTAGCGGAAGAAAATCTTGAG
GCATTAACAGAAGGTTTACCAAATTTGCTGAAGCACATTGCTAATTTAAA
AAATGTACTAGGTTTGCCGGTTGTGGTCGCCTTAAACCGTTTTGTATCAG
ATTCTGATGCAGAATTAGCGCTAATCCAAACCGCTTGTGCTAAACAAGGC
GTTGAAGTTTCATTAACAGAAGTTTGGGCTAGAAGTGCTGTCGGTGGCGT
CGATTTAGCGCATAAGGTGTTAAAAGCAATTGATGAACAACAAAATAATT
TCCAATTTGCTTACGATGTTAATGACCGTATTCAACATAAAATCACTGCA
ATAGCACAAAAAATTTATGGTGCAACCGATGTAAACTTTAGTGCTGAAGC
GCTTGCAGAAATTAAAAACTTAGAAAAATTAGCTTTAGATAAGTTACCAA
TCTGTATGGCAAAAACACAATATTCATTAAGCGATAGTGCTAAATTACTT
GGCTGTCCTACTGGTTTTAACATTACTGTGCGAAGTATTACTGTTTCAGC
GGGTGCTGGTTTTATTGTTGCAATTTGTGGCAGTATCATGCGAATGCCAG
GCCTACCTAAAAATCCAGCAACAAATCGGATTGATGTCGATGAAAACGGT
GTAATTAGCGGTTTGTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy