Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-3 IGR932 IGR937 IGR936 IGR933 IGR938 IGR939 IGR934 ssb, - HD1285 fhs, - HD1282 HD1283 secG, - HD1277 HD1284 mepA, - HD1275 nisP, - HD1278 nisP, - HD1280 topB, - HD1276 uvrA, - HD1286 ssb, - HD1285 fhs, - HD1282 HD1283 secG, - HD1277 HD1284 mepA, - HD1275 nisP, - HD1278 nisP, - HD1280 topB, - HD1276 uvrA, - HD1286 ssb, - HD1285 fhs, - HD1282 secG, - HD1277 HD1284 mepA, - HD1275 nisP, - HD1278 nisP, - HD1280 topB, - HD1276 uvrA, - HD1286 HD1283
* Calculated from Protein Sequence

Gene ID: HD1280

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nisP  

Definition:
serine protease

Gene Start:
1041965

Gene Stop:
1043860

Gene Length:
1896

Molecular Weight*:
69271

pI*:
9.30

Net Charge*:
5.20

EC:
3.4.-.-  

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table
Biotin metabolism
Lysine degradation

Secondary Evidence:
Kawai,E., Idei,A., Kumura,H., Shimazaki,K., Akatsuka,H. and Omori,K.
The ABC-exporter genes involved in the lipase secretion are clustered with the genes for lipase, alkaline protease, and serine protease homologues in Pseudomonas fluorescens no. 33.
Biochim. Biophys. Acta. 1446(3):377-382, 1999.
Medline: 99453738.

Ohnishi Y, Beppu T, Horinouchi S.
Two genes encoding serine protease homologues in Serratia marcescens and characterization of their products in Escherichia coli.
J Biochem (Tokyo). 121(5):902-13, 1997.
Medline: 97335937.

Comment:
0

Blast Summary:  PSI-Blast Search
Residues 1-631 are 31% similar to residues 290-930 of 19705252 Serine protease [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]. Otherwise, numerous moderate hits in gapped BLAST to serine proteases; e.g., residues 3-570 are 26% similar to residues 401-943 of the sequence for serine protease in Xylella fastidiosa [9106937]; residues 1-631 are 22% similar to residues 385-1034 of the sequence for serine protease h2 precursor in Serratia marcescens [7435686]; residues 1-568 are 24% similar to residues 448-1026 of the sequence for an autotransporter serine precursor in Neisseria meningitidis [7649690], also known as a serotype-1 specific precursor [7227230]; and residues 1-631 are 22% similar to residues 386-1036 of the sequence for serine protease h1 precursor in Serratia marcescens [7435685].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1280 is paralogously related to HD1094 (6e-14).


Pfam Summary:  Pfam Search
Residues 337 to 631 (E-value = 1.1e-07) place HD1280 in the Autotransporter family which is described as Autotransporter beta-domain (PF03797)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTNEQIKMTILSTATDIGAEGVDDVFGWGLLDVEKATKGPARFDKRLTDE
KDVVLNVDNNNANYYGYNYNPYQFENDISGDVGLVKKGNGHLILSGNSTF
TGKTELQQGSLAIYGKHYYSPMVIKENSSLYTRDTDFRHAIENHGYYYNN
GRTSVNNYRATPMAKLITSNDAKLVVNGEADLNGSKVALYSKEYVTNNGV
LSMPLVAQAIKGVPIIEPHGMYSVVGNLEDNALHVELKRENVLSYLKSNV
KFVDVMRENAAEAMEKTMVAIDNQLPTYRSLLSAPITKVLAELQQGKLND
KNEESTFDKLSGQIYASAQALTFQNAEAVNKDLSNRLDTLGTSADPTLAS
GAWASAIYANGKLTQPGFGEGKTQTLAGQVGADTMAADDVIVGAAMNYSK
ANVTFNRYGGNSQAKGVGVSLYSRLNNIYSTPVYLQGRLGFGSVNSDVER
ELVQETQQQKRKVNHRDKVISAYIESGYNLKQNDFTVTPFMGIAYDNVIR
GAFTETNSQLGLTAPKQAYAQTSGLVGLRVARQLRYANGMKTTLQGYVNH
QVAFNRQDLSYTAKYTGANNVLNHADFKVKGIGLVKNKTWLGIGSTTEIT
PNTTWYVNYDLKLENTKGYNNVVSTGIRVKF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGAATGAACAAATCAAAATGACAATTTTGAGTACGGCAACGGATAT
TGGTGCAGAAGGTGTTGATGATGTGTTTGGTTGGGGGCTATTGGATGTGG
AAAAAGCAACTAAAGGACCGGCTCGCTTTGATAAACGTTTGACTGATGAA
AAAGATGTTGTATTAAATGTTGATAATAACAATGCCAATTATTATGGCTA
TAATTATAATCCATATCAATTTGAGAATGATATATCAGGCGATGTTGGTT
TAGTAAAAAAAGGCAATGGGCATTTGATTTTATCTGGGAATAGTACTTTT
ACTGGTAAAACTGAATTACAGCAAGGTAGTCTGGCTATTTATGGTAAGCA
CTATTATTCGCCTATGGTTATAAAGGAAAATAGTTCATTATATACTCGTG
ATACAGATTTCAGGCATGCCATTGAAAATCATGGTTATTACTATAATAAC
GGACGTACTAGCGTTAATAATTATAGAGCAACACCAATGGCAAAATTAAT
TACATCAAACGATGCAAAACTCGTAGTTAATGGTGAAGCTGACCTCAATG
GCTCAAAAGTAGCATTATATTCAAAAGAATATGTTACTAATAATGGTGTG
TTGTCAATGCCATTAGTTGCTCAAGCAATAAAAGGAGTCCCTATAATTGA
GCCTCACGGAATGTATTCTGTAGTAGGAAATCTTGAAGATAATGCTTTAC
ATGTGGAGTTAAAACGTGAAAATGTTCTTTCATATTTGAAATCTAATGTT
AAGTTTGTCGATGTGATGAGAGAAAATGCAGCAGAGGCTATGGAAAAAAC
AATGGTCGCTATTGATAATCAACTACCTACCTATCGCTCCTTACTTTCTG
CGCCAATTACCAAAGTTCTTGCGGAGTTACAGCAAGGTAAACTGAACGAT
AAAAACGAAGAATCTACATTCGACAAACTCTCCGGGCAAATCTATGCTTC
TGCTCAAGCGTTAACCTTCCAAAATGCTGAAGCGGTGAATAAAGATTTAT
CTAACCGTTTAGATACTTTAGGCACATCAGCCGATCCAACATTAGCATCG
GGGGCTTGGGCGAGTGCAATCTATGCAAATGGTAAATTAACACAACCAGG
CTTTGGTGAAGGTAAAACGCAAACTTTAGCAGGGCAGGTCGGTGCTGATA
CTATGGCTGCCGATGATGTTATTGTAGGGGCTGCGATGAACTATTCTAAA
GCAAATGTTACTTTTAACCGCTATGGTGGAAACTCTCAAGCTAAAGGTGT
CGGTGTTTCACTTTACTCTCGTTTAAATAATATCTATTCAACGCCAGTAT
ATTTACAAGGTAGATTAGGCTTTGGCAGTGTTAATAGTGATGTAGAACGT
GAGTTAGTTCAAGAAACACAACAACAAAAACGTAAAGTAAACCACCGTGA
TAAAGTTATTTCTGCTTATATTGAGAGTGGCTATAATCTTAAACAAAATG
ATTTCACCGTAACGCCATTTATGGGGATAGCCTATGACAATGTTATTCGT
GGAGCATTTACAGAAACAAATAGTCAGTTAGGTTTAACTGCACCGAAACA
GGCCTATGCTCAAACGAGTGGTTTAGTTGGATTACGTGTAGCTCGCCAAC
TACGTTATGCCAACGGTATGAAAACCACTTTACAAGGTTATGTCAATCAT
CAAGTTGCCTTTAACCGACAAGATTTAAGCTATACTGCAAAATATACCGG
CGCTAATAATGTGCTTAATCATGCAGATTTTAAAGTGAAAGGTATTGGAT
TAGTGAAAAACAAAACATGGTTAGGTATTGGATCAACAACAGAAATTACA
CCAAATACTACTTGGTATGTTAATTACGATCTTAAATTAGAAAATACTAA
AGGTTATAATAATGTAGTAAGTACAGGTATCCGTGTTAAATTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy