Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-3 IGR932 IGR937 IGR931 IGR936 IGR933 IGR938 IGR934 ssb, - HD1285 fhs, - HD1282 HD1283 secG, - HD1277 HD1284 mepA, - HD1275 aroC, - HD1274 nisP, - HD1278 nisP, - HD1280 topB, - HD1276 ssb, - HD1285 fhs, - HD1282 HD1283 secG, - HD1277 HD1284 mepA, - HD1275 aroC, - HD1274 nisP, - HD1278 nisP, - HD1280 topB, - HD1276 ssb, - HD1285 fhs, - HD1282 secG, - HD1277 HD1284 mepA, - HD1275 aroC, - HD1274 nisP, - HD1278 nisP, - HD1280 topB, - HD1276 HD1283
* Calculated from Protein Sequence

Gene ID: HD1278

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nisP  

Definition:
serine protease

Gene Start:
1040786

Gene Stop:
1041964

Gene Length:
1179

Molecular Weight*:
44001

pI*:
10.00

Net Charge*:
10.36

EC:
 

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table

Secondary Evidence:
Kawai,E., Idei,A., Kumura,H., Shimazaki,K., Akatsuka,H. and Omori,K.
The ABC-exporter genes involved in the lipase secretion are clustered with the genes for lipase, alkaline protease, and serine protease homologues in Pseudomonas fluorescens no. 33.
Biochim. Biophys. Acta. 1446(3):377-382, 1999.
Medline: 99453738.

Ohnishi Y, Beppu T, Horinouchi S.
Two genes encoding serine protease homologues in Serratia marcescens and characterization of their products in Escherichia coli.
J Biochem (Tokyo). 121(5):902-13, 1997.
Medline: 97335937.

Comment:


Blast Summary:  PSI-Blast Search
Residues 126-391 are 28% similar to residues 34-317 of 19704758 Serine protease [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]. Otherwise, positions 125 to 392 are 27% (E value 1e-13) similar to dbj|BAA36466.1| (AB015053) (4115628) serine protease homologue between positions 63 and 321 in Pseudomonas fluorescens. Positions 125 to 392 are 25% (E value 1e-12) similar to emb|CAA07702.1| (AJ007828) (3646417) serine protease between positions 63 and 321 in Pseudomonas tolaasii. Positions 168 to 392 are 25% (E value 3e-11) similar to gb|AAF80995.1 (8895500) serine protease between positions 148 and 389 in Pseudomonas fluorescens.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1404
COG name: Subtilisin-like serine proteases
Functional Class: O
The phylogenetic pattern of COG1404 is A---Yq-c-BR----------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000209 (Serine proteases, subtilase family) with a combined E-value of 1.1e-11.
    IPB000209A    127-139
    IPB000209B    170-180
    IPB000209C    185-195
    IPB000209D    278-287
    IPB000209E    372-382


ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1278 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LFIYYCIIGKQKYWVVDNFIIAVIIANYFKINSGKERIFMLYKKTLLAVS
ILTSINALAYDYLDSSGYYGNHYGGYYGPSPSYSYDNYYSKNENYDYQGN
IIWRDKFRKYDPNDPNNKNAIENKLNGEGVLVGVLDSGFNNPFMGDDIRT
KFGGHAAIMKTGRVTFTGTHGISVSEMIAGNKDRHNNGVAPRTRLLLADI
SIGNASGVSPSLDIYNALWHNGARIFNQSFGVTKMVTGFSKDLFIDNTRF
FKKTNANYYAHQFNHGLLDFYRDKVKQDGLFIWAAGNERNDPNPSLEPGL
PHFEPDLKKGWISVVAVAARHQNGLGNFNWNNLKPYSQAGVAKDWSITAV
GDYRFDIHDLETARKVTMIQSGSSFSAPAVTGTAALVKQKYP$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTTATTTATTATTGTATAATTGGTAAACAAAAATACTGGGTGGTAGA
TAATTTTATAATAGCAGTAATAATTGCAAATTATTTTAAAATCAATTCAG
GTAAAGAAAGGATTTTTATGTTGTACAAAAAAACACTTTTAGCAGTAAGT
ATTTTAACTTCTATTAATGCTTTAGCTTATGACTATCTAGATAGTAGTGG
CTACTATGGAAACCATTATGGTGGTTACTACGGTCCATCTCCCAGTTATT
CTTACGATAATTATTATAGTAAGAATGAAAATTATGATTATCAAGGAAAT
ATTATATGGCGTGATAAATTTAGGAAATATGATCCTAACGATCCTAATAA
TAAAAACGCCATAGAAAATAAATTGAATGGTGAAGGTGTTCTAGTCGGTG
TGCTTGATAGTGGATTCAATAACCCATTTATGGGAGATGATATCAGAACA
AAATTTGGTGGTCATGCAGCAATTATGAAGACTGGGCGTGTTACTTTTAC
TGGTACTCATGGTATATCTGTCAGTGAGATGATTGCGGGTAATAAAGATC
GGCACAATAATGGAGTTGCTCCAAGAACTAGATTATTATTAGCTGATATA
TCTATAGGTAATGCTAGTGGTGTATCACCTTCTTTAGATATTTATAATGC
TTTATGGCATAATGGAGCAAGAATATTTAACCAATCTTTTGGTGTAACTA
AAATGGTGACAGGTTTTTCTAAGGACCTATTTATTGATAATACGAGGTTC
TTTAAAAAAACTAATGCAAATTATTATGCTCATCAATTTAATCATGGACT
ACTAGACTTTTATCGTGACAAAGTAAAACAAGATGGTTTATTTATCTGGG
CGGCTGGTAATGAACGTAATGATCCAAATCCATCTTTAGAGCCAGGATTA
CCTCATTTTGAACCTGATTTGAAAAAAGGCTGGATATCTGTTGTTGCAGT
TGCAGCAAGGCATCAAAATGGATTAGGAAATTTTAATTGGAATAATCTTA
AACCTTATTCTCAAGCTGGTGTGGCAAAAGATTGGAGTATTACAGCAGTA
GGTGATTATAGATTTGATATACATGATTTAGAAACTGCAAGAAAGGTTAC
AATGATTCAGAGTGGTTCATCTTTTTCAGCTCCGGCAGTAACAGGCACAG
CAGCGCTGGTCAAGCAAAAATATCCTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy