Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-3 IGR929 IGR932 IGR930 IGR931 IGR933 IGR934 secG, - HD1277 mepA, - HD1275 aroC, - HD1274 nisP, - HD1278 menE, - HD1271 nisP, - HD1280 topB, - HD1276 aefA,kefA, - HD1273 secG, - HD1277 mepA, - HD1275 aroC, - HD1274 nisP, - HD1278 menE, - HD1271 nisP, - HD1280 topB, - HD1276 aefA,kefA, - HD1273 secG, - HD1277 mepA, - HD1275 aroC, - HD1274 nisP, - HD1278 nisP, - HD1280 topB, - HD1276 aefA,kefA, - HD1273 aefA,kefA, - HD1272 menE, - HD1271 aefA,kefA, - HD1272
* Calculated from Protein Sequence

Gene ID: HD1275

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
mepA  

Definition:
penicillin-insensitive murein endopeptidase A

Gene Start:
1037326

Gene Stop:
1038156

Gene Length:
831

Molecular Weight*:
30412

pI*:
10.80

Net Charge*:
17.62

EC:
3.4.99.-  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table

Secondary Evidence:
Keck,W., van Leeuwen,A.M., Huber,M. and Goodell,E.W.
Cloning and characterization of mepA, the structural gene of the penicillin-insensitive murein endopeptidase from Escherichia coli. Mol. Microbiol. 4(2):209-219, 1990.
Medline: 90251161.

Comment:
From Genbank:[gi:1170923]
This protein is involved in the removal of murein from the sacculus. It may also facilitate integration of nascent murein strands into the sacculus by cleaving the peptide bonds between neighboring strands in mature murein.


Blast Summary:  PSI-Blast Search
Positions 24 to 272 are 58% (E value 2e-86) similar to sp|P44566|MEPA_HAEIN (1170923) penicillin-insensitive murein endopeptidase A homolog between positions 27 and 278 in Haemophilus influenzae Rd. Positions 21 to 270 are 48% (E value 1e-64) similar to sp|P14007|MEPA_ECOLI (126975) penicillin-insensitive murein endopeptidase precursor between positions 20 and 269 in Escherichia coli. Positions 31 to 244 are 44% (E value 8e-48) similar to gb|AAC43670.1 (719299) murein endopeptidase between positions 56 and 270 in Brucella abortus.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 24-271 are 59% similar to a (SIGNAL MUREIN PERIPLASMIC HYDROLASE) protein domain (PD039139) which is seen in Q9CNR6_PASMU.



Paralogs:  Local Blast Search

HD1275 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 36 to 275 (E-value = 2.2e-128) place HD1275 in the Peptidase_U6 family which is described as Penicillin-insensitive murein endopeptidase (PF03411)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNVLKSLLLFSFTLSSLVSQATLWEKIRQPVAGQPQSIGGYSNGCIIGAR
PLALKGNGYQVIRSIKNRYYGHPQLLSYLTDLAKRTRTAGLPPILIGDMG
MPAGGRFASGHASHQTGLDADIWLRFGPMDDKTARNPAGLATIMVNRTLQ
RVDEKRWTNQHTTLIRLAAQDQRVNRIFVNPAIKLKLCQTAGKNRAWLQK
IRPWYAHDSHFHVRLSCPSDARNCENQPPIAAGDGCGDELHSWFLPAPAN
TTAAKPKVIPMVPVQCQMILSSQGLN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGTATTGAAAAGCCTGCTTTTATTCAGTTTTACTTTATCTAGCCT
AGTCAGCCAAGCGACTCTGTGGGAGAAAATCCGCCAACCCGTTGCAGGGC
AACCGCAATCGATCGGTGGGTATAGTAATGGTTGTATTATTGGTGCTCGG
CCGTTAGCATTAAAAGGCAATGGTTACCAAGTTATTCGCTCAATTAAAAA
TCGCTATTATGGCCATCCTCAGTTATTAAGTTATTTAACTGATTTAGCTA
AACGCACTCGGACAGCAGGTCTACCACCAATTTTAATTGGTGATATGGGC
ATGCCCGCCGGTGGACGTTTTGCTTCAGGTCATGCTAGCCATCAGACGGG
ATTAGATGCAGATATTTGGCTACGTTTTGGACCAATGGATGATAAAACCG
CCCGTAATCCAGCCGGTTTGGCTACTATTATGGTAAATCGCACTTTACAA
CGTGTAGATGAAAAACGTTGGACAAACCAACACACTACTTTAATTAGACT
GGCTGCCCAAGATCAGCGAGTGAACCGTATTTTTGTCAATCCAGCGATTA
AGCTTAAATTATGCCAAACAGCGGGTAAAAATCGTGCTTGGTTACAAAAA
ATCCGACCTTGGTATGCGCATGACTCACATTTCCATGTTCGATTAAGTTG
TCCATCTGATGCTCGAAATTGCGAGAATCAGCCACCGATTGCCGCAGGTG
ATGGTTGTGGTGATGAATTGCATTCTTGGTTTTTGCCAGCGCCGGCTAAT
ACGACTGCTGCTAAGCCAAAAGTGATACCAATGGTGCCCGTACAATGCCA
AATGATTCTTTCCTCACAAGGCCTTAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy