Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-3 IGR929 IGR932 IGR930 IGR931 IGR933 IGR934 secG, - HD1277 mepA, - HD1275 aroC, - HD1274 nisP, - HD1278 menE, - HD1271 topB, - HD1276 aefA,kefA, - HD1273 secG, - HD1277 mepA, - HD1275 aroC, - HD1274 nisP, - HD1278 menE, - HD1271 topB, - HD1276 aefA,kefA, - HD1273 secG, - HD1277 mepA, - HD1275 aroC, - HD1274 nisP, - HD1278 menE, - HD1271 topB, - HD1276 aefA,kefA, - HD1273 aefA,kefA, - HD1272 aefA,kefA, - HD1272
* Calculated from Protein Sequence

Gene ID: HD1274

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
aroC  

Definition:
chorismate synthase

Gene Start:
1036192

Gene Stop:
1037274

Gene Length:
1083

Molecular Weight*:
38759

pI*:
8.00

Net Charge*:
3.89

EC:
4.6.1.4  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Charles,I.G., Lamb,H.K., Pickard,D., Dougan,G. and Hawkins,A.R.
Isolation, characterization and nucleotide sequences of the aroC genes encoding chorismate synthase from Salmonella typhi and Escherichia coli.
J. Gen. Microbiol. 136(Pt 2):353-358,1990.
Medline: 90218018.

White,P.J., Millar,G. and Coggins,J.R.
The overexpression, purification and complete amino acid sequence of chorismate synthase from Escherichia coli K12 and its comparison with the enzyme from Neurospora crassa.
Biochem. J. 251(2):313-322, 1988.
Medline: 88293429.

Dmitrenko O, Wood HB Jr, Bach RD, Ganem B.
A theoretical study of the chorismate synthase reaction.
Org Lett. 2001 Dec 27;3(26):4137-40.
PMID: 11784161

Comment:
For other "aro" genes, see HD1383 (aroA), HD1475 (aroG), HD0415 (aroE), HD0422 (aroB), HD0423 (aroK), HD0444 (aroF), HD0632 (aroQ).

Blast Summary:  PSI-Blast Search
Residues 1-359 are 82% similar to 16272160 chorismate synthase (aroC) from Haemophilus influenzae Rd. Residues 1-358 are 81% similar to 15602224 AroC from Pasteurella multocida.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0082
COG name: Chorismate synthase
Functional Class:  E
The phylogenetic pattern of COG0082 is amt-yqvcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000453 (Chorismate synthase) with a combined E-value of 1.4e-145.
    IPB000453A    10-51
    IPB000453B    57-81
    IPB000453C    103-131
    IPB000453D    233-269
    IPB000453E    278-306
    IPB000453F    326-350


ProDom Summary:  Protein Domain Search
Residues 1-359 are 82% similar to a (CHORISMATE SYNTHASE LYASE BIOSYNTHESIS) protein domain (PD002941) which is seen in AROC_HAEIN.



Paralogs:  Local Blast Search
HD1274 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 10 to 356 (E-value = 1.3e-226) place HD1274 in the Chorismate_synt family which is described as Chorismate synthase (PF01264)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MAGNSIGQLFKVTTFGESHGLALGCIIDGLPPNMALSEADIQPDLDRRKP
GTSRYTTARREADQVHILSGVFAGKTTGTSIGLIIKNNDQRSSDYREIMD
VFRPGHADYTYQQKYGIRDYRGGGRSSARETAMRVAAGAIAKKYLSEQFG
IQVRAYLAQIGTIKIDPTCVADIAQIDWKYVNNNPFFCPDATAVPKFDEL
IRCLKKEGDSMGAKLTVIAENVPTGLGEPVFDRLDADLAHALMSINAVKA
VEIGDGFAVVSQKGSQHRDQMTPNGFLSNHAGGILGGISSGQPIIAHIAF
KPTSSIMVPGKSVNMDNQAIELVTKGRHDPCVGIRAVPIAEAMVAIVLLD
HLLRFKAQCG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGGCAATAGCATTGGACAGTTATTTAAAGTGACCACTTTTGGCGA
ATCACATGGACTTGCTTTAGGATGTATAATTGACGGACTCCCGCCCAATA
TGGCGTTATCTGAGGCGGATATTCAACCAGATTTAGATCGGCGTAAACCC
GGCACATCACGTTATACCACTGCTCGCCGAGAAGCCGATCAAGTACACAT
TTTATCGGGAGTATTTGCGGGAAAAACGACCGGTACTAGCATTGGTTTAA
TCATTAAAAATAATGATCAACGCTCAAGTGATTATCGTGAAATTATGGAT
GTATTTCGTCCAGGACACGCTGATTATACTTATCAACAAAAATATGGTAT
TCGTGATTATCGTGGTGGCGGACGTTCATCTGCGCGAGAGACCGCAATGC
GAGTGGCCGCCGGAGCGATTGCTAAAAAATATTTAAGTGAACAATTTGGC
ATTCAAGTACGGGCTTATTTAGCTCAAATAGGCACAATTAAAATTGATCC
TACTTGTGTAGCGGATATTGCGCAAATTGATTGGAAATATGTAAACAACA
ATCCGTTTTTTTGCCCTGACGCAACGGCAGTACCAAAATTTGATGAATTA
ATTCGTTGTTTGAAGAAAGAAGGCGATTCAATGGGGGCTAAATTAACCGT
GATTGCAGAAAATGTCCCAACAGGTTTAGGCGAACCTGTTTTTGACCGCT
TAGATGCTGATTTAGCTCACGCATTAATGTCAATTAATGCCGTAAAAGCG
GTTGAAATTGGAGATGGTTTTGCGGTAGTGAGCCAAAAAGGTAGTCAGCA
TCGTGATCAAATGACACCAAATGGCTTTCTTTCTAATCATGCCGGGGGCA
TTTTAGGTGGTATTAGTTCTGGTCAGCCTATTATAGCACACATTGCCTTT
AAGCCGACTTCTAGCATTATGGTGCCGGGTAAATCGGTTAATATGGATAA
TCAAGCGATAGAATTAGTCACTAAAGGACGCCATGATCCTTGTGTGGGTA
TCCGCGCGGTGCCGATAGCGGAAGCAATGGTTGCTATTGTATTGCTTGAT
CACCTACTTCGTTTCAAAGCACAGTGTGGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy