Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR929 IGR930 IGR927 IGR926 IGR925 HD1267 fabI,envM, - HD1266 ybfF, - HD1268 rnb, - HD1264 seqA, - HD1270 aroC, - HD1274 menE, - HD1271 aefA,kefA, - HD1273 HD1267 fabI,envM, - HD1266 ybfF, - HD1268 rnb, - HD1264 seqA, - HD1270 aroC, - HD1274 menE, - HD1271 aefA,kefA, - HD1273 HD1267 fabI,envM, - HD1266 ybfF, - HD1268 rnb, - HD1264 seqA, - HD1270 aroC, - HD1274 menE, - HD1271 aefA,kefA, - HD1273 aefA,kefA, - HD1272 aefA,kefA, - HD1272
* Calculated from Protein Sequence

Gene ID: HD1271

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
menE  

Definition:
O-succinylbenzoate-CoA synthase

Gene Start:
1031423

Gene Stop:
1032841

Gene Length:
1419

Molecular Weight*:
52732

pI*:
5.90

Net Charge*:
-5.39

EC:
6.2.1.26  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Ubiquinone biosynthesis

Secondary Evidence:
Meganathan R, Bentley R.
Biosynthesis of o-succinylbenzoic acid in a men- Escherichia coli mutant requires decarboxylation of L-glutamate at the C-1 position.
Biochemistry. 1981 Sep 1;20(18):5336-40.
PMID: 6117313

Comment:


Blast Summary:  PSI-Blast Search
Positions 39 to 467 are 46% (E value 5e-97) similar to sp|P44565|MENE_HAEIN (1170918) O-succinylbenzoic acid-CoA ligase between positions 27 and 447 in Haemophilus influenzae Rd. Positions 4 to 462 are 37% (E value 3e-79) similar to dbj|BAA16080.1| (D90856) (1799609) O-succinylbenzoic acid-CoA ligase between positions 2 and 443 in Escherichia coli. Positions 4 to 462 are 37% (E value 3e-79) similar to sp|P37353|MENE_ECOLI (2506185) O-succinylbenzoic acid-CoA ligase between positions 3 and 444 in Escherichia coli.

HD1271 is similar to acylglycerophosphoethanolamine acyltransferase from C. pneumoniae (CPn0922) and C. trachomatis (CT776), and to long-chain-fatty-acid--CoA ligase from T. pallidum (TP0145). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 3 clades of COG2228
COG name: o-Succinylbenzoate-CoA synthase
Functional Class: H
The phylogenetic pattern of COG2228 is a------cebRh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000873 (AMP-dependent synthetase and ligase) with a combined E-value of 7.2e-07.
    IPB000873A    149-164
    IPB000873B    184-194


ProDom Summary:  Protein Domain Search
Residues 195-280 are 52% similar to a (LIGASE O-SUCCINYLBENZOIC COMPLETE) protein domain (PD403106) which is seen in MENE_ECOLI.

Residues 144-194 are 50% similar to a (LIGASE BIOSYNTHESIS MENAQUINONE OSB-COA) protein domain (PD406253) which is seen in Q9CNR8_PASMU.

Residues 186-358 are 30% similar to a (COMPLETE PROTEOME LIGASE) protein domain (PD038329) which is seen in Q50170_MYCLE.

Residues 281-350 are 61% similar to a (LIGASE O-SUCCINYLBENZOIC ACID--COA) protein domain (PD402988) which is seen in Q9CNR8_PASMU.

Residues 358-409 are 75% similar to a (LIGASE SYNTHETASE PHOSPHOPANTETHEINE) protein domain (PD000081) which is seen in Q9CNR8_PASMU.



Paralogs:  Local Blast Search
HD1271 is paralogously related to HD1176 (2e-06).


Pfam Summary:  Pfam Search
Residues 40 to 393 (E-value = 2.6e-52) place HD1271 in the AMP-binding family which is described as AMP-binding enzyme (PF00501)

PDB Hit:
pdb|1AMU|B Chain B, Phenylalanine Activating Domain Of Gramicid... 68 2e-012

Gene Protein Sequence:
MVTFSLFPTAYWAEQKAQESAIIWQKGKQLDATAVPHQLSWADFHQTILK
TAEYFHVQGITSTKLIAYSGQSKFNGLLCYCTALAIGVPILMLNPALNEG
QRQTILSDNQVEFLITDQLFKDLLADILPQTTAYSLSELNIDQPATLTLT
SGSTGSPKAVVHSIRNHLENAVGVCQLMHFTQTDCWLLSLPLFHVSGQGI
VWRWLLQGATLYLNDAKAQFFDCLANVSHASLVPTQLQRYLKERGTNTLE
QKFLLGGSAIPATLIQQAQQQGITTYAGYGMTEMASTICAVENEIDNVGR
PLAGRSIRIVENEIWVKGAGLALGYWQKNGEIQPLVNQQGWLQTKDCGKW
NQQGQLVVKGRLDNMFISGGENIQPEEIEQLIYQSSWVQQVFVLPKEDSE
FGQRPVAIIQFNNGDFTENVTKLTAWLTDKLEKFKLPIAYYPLNIQDYEQ
QGNIKIARQQVQTALTKLLGQN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTCACATTTTCCCTTTTTCCTACCGCGTATTGGGCAGAACAGAAAGC
TCAAGAGTCTGCTATTATATGGCAAAAGGGAAAACAGCTTGATGCTACGG
CTGTTCCTCATCAGCTGAGTTGGGCTGATTTTCATCAAACCATTCTTAAA
ACTGCGGAATACTTCCATGTTCAAGGTATCACTTCAACTAAGTTAATAGC
TTATTCAGGGCAATCAAAGTTCAATGGGCTATTATGTTATTGCACTGCAT
TGGCGATCGGTGTCCCGATCTTAATGTTAAATCCCGCGTTAAATGAAGGG
CAACGCCAAACAATTCTATCTGATAATCAAGTTGAGTTTTTGATTACCGA
TCAGCTGTTTAAAGATTTATTAGCGGATATTTTGCCACAAACAACCGCCT
ATAGCTTGTCAGAACTCAATATCGATCAGCCCGCAACATTAACGCTCACT
TCAGGCTCTACAGGATCACCCAAAGCGGTCGTTCACTCTATTCGTAATCA
TTTAGAAAATGCGGTTGGAGTGTGCCAATTAATGCACTTTACGCAGACGG
ATTGTTGGCTATTAAGTTTACCGCTTTTTCACGTTTCCGGACAAGGCATT
GTTTGGCGTTGGTTATTACAAGGCGCCACGCTTTATTTAAATGATGCGAA
AGCGCAATTTTTTGATTGTTTAGCCAATGTTTCGCACGCTTCTTTGGTGC
CGACGCAATTACAACGCTATTTAAAAGAACGGGGAACCAATACGCTTGAG
CAAAAATTTTTATTAGGAGGGAGTGCCATTCCTGCAACATTAATTCAGCA
AGCACAACAACAAGGTATTACCACTTATGCAGGTTATGGTATGACAGAGA
TGGCATCAACAATTTGTGCGGTTGAAAATGAAATAGATAATGTAGGTCGG
CCATTAGCTGGGCGTTCAATACGCATTGTAGAAAATGAAATTTGGGTAAA
AGGAGCGGGTTTAGCATTAGGTTATTGGCAAAAAAATGGTGAAATTCAAC
CGCTTGTTAATCAACAAGGTTGGTTACAGACTAAAGATTGTGGTAAATGG
AACCAACAAGGTCAATTAGTCGTCAAAGGGCGATTAGATAATATGTTTAT
TTCAGGTGGGGAAAATATTCAGCCAGAAGAAATAGAACAGCTGATTTATC
AATCCAGTTGGGTGCAACAAGTATTTGTTCTTCCCAAAGAAGATAGCGAA
TTTGGCCAGCGACCGGTTGCGATTATTCAATTTAATAATGGTGATTTTAC
TGAAAATGTTACAAAGCTGACCGCTTGGTTAACCGATAAATTAGAAAAAT
TTAAGTTGCCGATCGCGTATTATCCGTTAAATATCCAAGATTATGAACAA
CAGGGCAACATTAAAATTGCTAGACAACAAGTGCAAACAGCATTAACTAA
ATTATTAGGGCAAAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy