Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Val-4 IGR929 IGR922 IGR921 IGR924 IGR927 IGR926 IGR925 IGR923 HD1259 HD1261 HD1267 fabI,envM, - HD1266 ybfF, - HD1268 apaH, - HD1263 perM, - HD1258 rnb, - HD1264 seqA, - HD1270 aefA,kefA, - HD1272 menE, - HD1271 HD1259 HD1261 HD1267 fabI,envM, - HD1266 ybfF, - HD1268 apaH, - HD1263 perM, - HD1258 rnb, - HD1264 seqA, - HD1270 aefA,kefA, - HD1272 menE, - HD1271 HD1261 HD1267 fabI,envM, - HD1266 ybfF, - HD1268 apaH, - HD1263 perM, - HD1258 rnb, - HD1264 HD1259 seqA, - HD1270 aefA,kefA, - HD1272 menE, - HD1271
* Calculated from Protein Sequence

Gene ID: HD1266

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
fabI  envM  

Definition:
enoyl-[acyl-carrier-protein] reductase

Gene Start:
1029041

Gene Stop:
1028253

Gene Length:
789

Molecular Weight*:
28095

pI*:
5.70

Net Charge*:
-3.93

EC:
1.3.1.9  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis

Secondary Evidence:
Kater,M.M., Koningstein,G.M., Nijkamp,H.J. and Stuitje,A.R. 1994.
The use of a hybrid genetic system to study the functional relationship between prokaryotic and plant multi-enzyme fatty acid
synthetase complexes.
Plant Mol. Biol. 25(5):771-790.
[Medline: 94355651]


Comment:
For other "fab" genes, see HD1188 (fabZ), HD0612 (fabB), HD0707 (fabD), HD0708 (fabG), HD0774 (fabH).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to enoyl-[acyl-carrier-protein] reductases; e.g., residues 1-262 are 93% similar to an enoyl-(acyl-carrier-protein) reductase (U32846) of Haemophilus influenzae Rd, residues 1-259 are 73% similar to an enoyl-[acyl-carrier-protein] reductase (AE000227) of Escherichia coli, and residues 1-262 are 63% similar to an enoyl-(acyl-carrier protein) reductase (AF104262) of Pseudomonas aeruginosa.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0623
COG name: Enoyl-[acyl-carrier-protein] reductase (NADH)
Functional Class: I
The phylogenetic pattern of COG0623 is -----q-cebrhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 64-135 are 54% similar to a (OXIDOREDUCTASE DEHYDROGENASE COMPLETE PROTEOME) protein domain (PD126102) which is seen in Q9RE03_LEGPN.

Residues 136-164 are 89% similar to a (ALCOHOL DEHYDROGENASE SHORT-CHAIN HOMOLOG) protein domain (PD301334) which is seen in O31205_PASHA.

Residues 183-250 are 97% similar to a (OXIDOREDUCTASE DEHYDROGENASE COMPLETE PROTEOME NAD) protein domain (PD000197) which is seen in FABI_HAEIN.

Residues 151-200 are 54% similar to a (REDUCTASE ENOYL-ACYL-CARRIER-PROTEIN) protein domain (PD019811) which is seen in Q9LAH3_CORGL.

Residues 140-182 are 97% similar to a (REDUCTASE OXIDOREDUCTASE) protein domain (PD415371) which is seen in FABI_HAEIN.

Residues 3-53 are 92% similar to a (REDUCTASE OXIDOREDUCTASE ENOYL-ACP NADH) protein domain (PD005556) which is seen in FABI_HAEIN.

Residues 183-259 are 42% similar to a (REDUCTASE NADH ENOYL-ACYL-CARRIER-PROTEIN) protein domain (PD029146) which is seen in FABI_BUCAI.

Residues 140-184 are 64% similar to a (OXIDOREDUCTASE DEHYDROGENASE COMPLETE PROTEOME NAD) protein domain (PD003795) which is seen in FABI_BACSU.

Residues 59-135 are 92% similar to a (REDUCTASE ENOYL-ACP OXIDOREDUCTASE NADH) protein domain (PD009629) which is seen in O31205_PASHA.

Residues 184-254 are 52% similar to a (PROTEOME ENOYL-ACP COMPLETE) protein domain (PD388951) which is seen in Q9CI02_LACLA.



Paralogs:  Local Blast Search
HD1266 is paralogously related to HD0708 (4e-12).


Pfam Summary:  Pfam Search
Residues 9 to 251 (E-value = 6e-13) place HD1266 in the adh_short family which is described as short chain dehydrogenase (PF00106)

PDB Hit:
pdb|1C14|A Chain A, Crystal Structure Of E Coli Enoyl Reductase... 374 9e-105
pdb|1QSG|G Chain G, Crystal Structure Of Enoyl Reductase Inhibi... 374 9e-105
pdb|1DFH|B Chain B, X-Ray Structure Of Escherichia Coli Enoyl R... 372 3e-104

Gene Protein Sequence:
MSFLAGKRILVTGLASNRSIAYGIAKAMKAQGAELAFTYLNDKLQPRVEE
FVKEFGSDIVLPLDVATDESIHNCFTELNKHWQKFDGFVHAIAFAPGDQL
DGDYVNAATRDGYRIAHDISAYSFVAMAQAARPYLNENASLLTLSYLGAE
RAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGI
KNFKKMLSAFEKTAALRRTVTIDDVGNSAAFLCSDLASGITGEIVHVDAG
FSITAMGELGEE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCTTTTTAGCGGGTAAACGTATTTTAGTGACAGGTCTTGCAAGTAA
CCGTTCAATTGCTTACGGTATTGCTAAAGCAATGAAGGCACAAGGTGCTG
AATTAGCCTTCACTTATTTAAATGATAAACTACAACCACGCGTTGAAGAA
TTTGTCAAAGAATTTGGTTCAGATATTGTGCTACCATTAGATGTTGCAAC
AGATGAATCTATTCATAATTGCTTTACTGAATTAAACAAGCACTGGCAAA
AATTTGATGGTTTCGTCCATGCAATTGCTTTTGCACCTGGCGATCAACTC
GATGGAGATTATGTAAATGCGGCAACACGTGATGGCTATCGTATTGCCCA
CGATATCAGTGCCTATAGTTTTGTGGCAATGGCACAAGCTGCACGCCCAT
ATTTAAATGAAAATGCCTCATTGTTGACATTAAGCTACTTAGGTGCTGAA
CGTGCAATTCCTAACTACAATGTAATGTGTTTAGCTAAAGCCTCCTTAGA
AGCAGCAACACGTGTAATGGCAGCAGACTTAGGTAAAGAAGGCATTCGTG
TTAATGCTATTTCAGCCGGTCCAATCCGCACTTTGGCCGCTTCAGGAATT
AAAAACTTCAAGAAAATGCTCTCTGCATTTGAAAAAACAGCCGCATTACG
TCGTACAGTAACCATTGATGATGTGGGTAATTCCGCTGCATTTTTATGTT
CTGATTTAGCTTCAGGCATCACGGGTGAAATAGTACATGTAGATGCCGGT
TTTAGTATCACAGCAATGGGTGAACTAGGCGAAGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy