Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Val-4 IGR922 IGR919 IGR921 IGR924 IGR920 IGR926 IGR925 IGR923 HD1259 HD1261 HD1267 fabI,envM, - HD1266 ybfF, - HD1268 apaH, - HD1263 perM, - HD1258 queA, - HD1257 rnb, - HD1264 rec2, - HD1256 HD1259 HD1261 HD1267 fabI,envM, - HD1266 ybfF, - HD1268 apaH, - HD1263 perM, - HD1258 queA, - HD1257 rnb, - HD1264 rec2, - HD1256 HD1261 HD1267 fabI,envM, - HD1266 ybfF, - HD1268 apaH, - HD1263 perM, - HD1258 queA, - HD1257 rnb, - HD1264 HD1259 rec2, - HD1256
* Calculated from Protein Sequence

Gene ID: HD1263

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
apaH  

Definition:
bis(5'-nucleosyl)-tetraphosphatase

Gene Start:
1026025

Gene Stop:
1025213

Gene Length:
813

Molecular Weight*:
31396

pI*:
6.70

Net Charge*:
-1.63

EC:
3.6.1.41  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Guranowski,A., Jakubowski,H. and Holler,E.
Catabolism of diadenosine 5",5""-P1,P4-tetraphosphate in procaryotes. Purification and properties of diadenosine 5",5""-P1,P4-tetraphosphate (symmetrical) pyrophosphohydrolase from Escherichia coli K12.
J. Biol. Chem. 258(24):14784-14789, 1983.
Medline: 84087863

Blanchin-Roland,S., Blanquet,S., Schmitter,J.M. and Fayat,G.
The gene for Escherichia coli diadenosine tetraphosphatase is located immediately clockwise to folA and forms an operon with ksgA.
Mol. Gen. Genet. 205(3):515-522, 1986.
Medline: 87172305

Azakami,H., Sugino,H. and Murooka,Y.
Cloning and nucleotide sequence of a negative regulator gene for Klebsiella aerogenes arylsulfatase synthesis and identification of the gene as folA.
J. Bacteriol. 174(7):2344-2351, 1992.
Medline: 92202165


Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to bis(5"-nucleosyl)-tetraphosphatases and serine/threonine protein phosphatase 2B; e.g., residues 1-270 are 55% similar to a diadenosine tetraphosphatase (AF043998) of Actinobacillus actinomycetemcomitans, residues 1-270 are 57% similar to bis(5"-nucleosyl)-tetraphosphatase (symmetrical) (B64077) of Haemophilus influenzae Rd, residues 1-266 are 50% similar to a bis(5"-nucleosyl)-tetraphosphatase (symmetrical) (A26221) of Escherichia coli, and residues 5-129 are 32% similar to a serine/threonine protein phosphatase 1 (U80886) of Microcystis aeruginosa.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0639
COG name: Diadenosine tetraphosphatase and related serine/threonine protein phosphatases
Functional Class:  T
The phylogenetic pattern of COG0639 is Am-KY-VcEb-H---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 127-266 are 57% similar to a (DIADENOSINE HYDROLASE) protein domain (PD013620) which is seen in APAH_PASMU.

Residues 7-71 are 50% similar to a (DIADENOSINE HYDROLASE TETRAPHOSPHATASE) protein domain (PD389880) which is seen in APAH_BURPS.

Residues 6-126 are 55% similar to a (HYDROLASE IRON MANGANESE PHOSPHATASE) protein domain (PD000252) which is seen in APAH_ACTAC.



Paralogs:  Local Blast Search

HD1263 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 231 (E-value = 2.2e-16) place HD1263 in the Metallophos family which is described as Calcineurin-like phosphoesterase (PF00149)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MATYIMGDLHGCFTEFQQLLDKISYNPNYDELWLTGDIVARGEHSLACLR
FIKDPKNNIKTVLGNHDLHLLATLVGIKKVKPTDKLEALFSAPDRLELQH
WLRKQPLMVQHPTHNFLLVHAGISPEWDLSTTLSCAREAEMILQSDNYAD
YLAEMYDNTPDQWQDNLTGIARWRYILNAFTRMRFCYADKRLDFSCKLPI
EKAPVTLKPWLELDNPLYDTHDILFGHWASLMGKTSRSNIYALDTGCVWG
NHLTIINWETKQIFRQERLK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGACTTATATTATGGGTGACTTGCATGGTTGTTTTACTGAGTTTCA
GCAACTGCTTGACAAAATCAGCTATAACCCTAACTATGATGAATTATGGC
TAACGGGAGATATCGTTGCGCGTGGTGAACATTCATTAGCTTGCTTACGC
TTTATAAAAGATCCCAAAAACAATATCAAAACGGTATTAGGCAATCATGA
TCTGCATCTCTTAGCCACGTTAGTCGGGATCAAAAAAGTAAAACCAACAG
ATAAACTCGAAGCTCTTTTTTCTGCACCTGATCGCCTTGAGTTACAACAC
TGGCTTAGAAAACAACCACTCATGGTTCAACACCCAACACACAACTTTTT
ATTAGTTCATGCGGGCATTAGTCCAGAGTGGGACCTTAGCACAACGCTTA
GTTGCGCACGTGAAGCCGAAATGATTTTACAAAGCGATAACTATGCCGAT
TATCTTGCTGAAATGTATGACAATACTCCCGATCAATGGCAGGATAATTT
AACAGGCATAGCACGTTGGCGTTATATCCTCAATGCATTTACTCGAATGC
GTTTTTGTTACGCCGATAAGCGGTTAGATTTTAGTTGTAAATTGCCGATT
GAAAAAGCGCCAGTAACGCTAAAACCTTGGCTTGAACTCGATAACCCATT
ATACGATACGCACGATATTCTATTTGGCCATTGGGCAAGCTTAATGGGGA
AAACGAGCCGAAGCAATATTTATGCCCTTGATACGGGCTGCGTATGGGGT
AATCATCTAACCATCATAAATTGGGAGACTAAACAAATTTTTCGGCAAGA
ACGCTTAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy