Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Val-4 IGR922 IGR919 IGR921 IGR924 IGR920 IGR918 IGR917 IGR923 HD1259 dgkA, - HD1253 HD1261 cpdB,ushA, - HD1251 apaH, - HD1263 perM, - HD1258 queA, - HD1257 rnb, - HD1264 HD1254 rec2, - HD1256 HD1259 dgkA, - HD1253 HD1261 cpdB,ushA, - HD1251 apaH, - HD1263 perM, - HD1258 queA, - HD1257 rnb, - HD1264 HD1254 rec2, - HD1256 HD1261 apaH, - HD1263 perM, - HD1258 queA, - HD1257 rnb, - HD1264 HD1252 cpdB,ushA, - HD1251 HD1259 dgkA, - HD1253 HD1252 HD1254 rec2, - HD1256
* Calculated from Protein Sequence

Gene ID: HD1257

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
queA  

Definition:
S-adenosylmethionine:tRNA ribosyltransferase-isomerase (Queuosine biosynthesis protein queA)

Gene Start:
1022923

Gene Stop:
1021838

Gene Length:
1086

Molecular Weight*:
40116

pI*:
7.10

Net Charge*:
0.77

EC:
5.-.-.-  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Lipopolysaccharide biosynthesis
Pentose and glucuronate interconversions

Secondary Evidence:
Reuter,K., Slany,R., Ullrich,F. and Kersten,H.
Structure and organization of Escherichia coli genes involved in
biosynthesis of the deazaguanine derivative queuine, a nutrient
factor for eukaryotes
J. Bacteriol. 173 (7), 2256-2264 (1991)
Medline: 91177815


Slany,R.K., Bosl,M., Crain,P.F. and Kersten,H.
A new function of S-adenosylmethionine: the ribosyl moiety of
AdoMet is the precursor of the cyclopentenediol moiety of the tRNA
wobble base queuine
Biochemistry 32 (30), 7811-7817 (1993)
Medline: 93349860


Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to queuosine biosynthesis protein (queA). Residues 3-355 are 71% similar to this protein from Pasteurella multocida (13431796|) and Haemophilus influenzae (16272205|).

No similarities to C. trachomatis, C. pneumoniae, T. pallidum, U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0809
COG name: S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase)
Functional Class: J
The phylogenetic pattern of COG0809 is -----qvceb-huj--o---x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003699 (Queuosine biosynthesis protein) with a combined E-value of 2.1e-138.
    IPB003699A    1-31
    IPB003699B    43-72
    IPB003699C    144-160
    IPB003699D    166-203
    IPB003699E    252-267
    IPB003699F    300-350


ProDom Summary:  Protein Domain Search
Residues 3-350 are 72% similar to a (QUEUOSINE BIOSYNTHESIS TRANSFERASE) protein domain (PD009740) which is seen in QUEA_PASMU.



Paralogs:  Local Blast Search


HD1257 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 222 (E-value = 2.6e-118) place HD1257 in the Queuosine_synth family which is described as Queuosine biosynthesis protein (PF02547)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VLVSDFHFNLPDELIARYPKDERTASRLLHLNGESGKFSDLHFSDLLDHI
NPGDLLIFNNTRVIPARLYGRKESGGKLEVLIERVLDEHHCLAHIRCSKA
PKAGTKLILGEDKLGIGNGLEATMISRHDTLFELRFNATTPLFTLLQQAG
HIPLPPYIDRPDEDFDQERYQTVYSKVLGAVAAPTAGLHFDNPMLDKLKA
KGVNMAFVTLHVGAGTFQPVRVENILEHNMHAEYAEVTQAVVDQILATKA
AGKRVIAVGTTSVRSIESAAQATQPTGKLIAPFFSDTNIFLYPGKTFKIV
DVLITNFHLPESTLIMLVSAFAGYRHTMNAYQHAVQQKYRFFSYGDAMLI
NKNPNALNDLP$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTAGTTTCTGATTTCCATTTTAATTTACCTGATGAATTAATTGCACG
TTACCCAAAAGATGAACGTACAGCAAGCCGTTTATTACATTTAAATGGCG
AAAGCGGTAAATTTAGTGATTTACATTTTTCTGATCTATTAGATCATATC
AACCCTGGCGACTTATTAATTTTTAACAATACACGCGTTATTCCCGCCCG
CCTTTATGGACGCAAAGAAAGCGGTGGAAAACTTGAAGTATTAATCGAAC
GTGTATTAGATGAACATCACTGTTTAGCCCATATTCGTTGTTCAAAAGCA
CCTAAAGCAGGAACTAAATTAATTTTAGGTGAAGATAAATTAGGGATTGG
CAATGGTTTAGAAGCAACAATGATAAGCCGCCACGATACCTTATTTGAGC
TACGCTTTAACGCCACCACTCCACTCTTTACCTTACTGCAACAAGCGGGT
CATATACCATTGCCACCTTATATTGATCGCCCTGATGAAGACTTTGATCA
AGAACGCTACCAAACCGTTTATAGCAAAGTATTAGGCGCGGTAGCTGCAC
CAACTGCCGGCTTACATTTTGATAATCCGATGCTTGATAAATTAAAAGCT
AAAGGAGTAAATATGGCTTTTGTCACGCTACACGTTGGTGCGGGTACATT
CCAGCCTGTACGGGTTGAAAATATTCTTGAACATAACATGCACGCAGAAT
ATGCAGAAGTGACGCAAGCGGTCGTTGATCAAATTCTTGCCACTAAAGCT
GCCGGTAAACGTGTGATTGCAGTAGGGACAACTTCCGTACGCTCTATTGA
AAGCGCGGCACAAGCTACCCAACCAACAGGTAAATTGATTGCGCCTTTTT
TCTCAGATACCAACATTTTTTTATATCCCGGTAAAACATTCAAAATCGTG
GACGTATTAATCACCAATTTCCACTTGCCTGAATCTACATTAATTATGCT
CGTCTCCGCTTTTGCAGGCTATCGGCATACGATGAATGCTTATCAACATG
CAGTGCAACAAAAATACCGCTTCTTTAGCTATGGTGACGCAATGCTTATC
AATAAAAATCCTAATGCATTAAATGATTTGCCGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy