Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR913 IGR919 IGR914 IGR915 IGR918 IGR916 IGR917 IGR912 HD1248 dgkA, - HD1253 ushA, - HD1250 cpdB,ushA, - HD1251 queA, - HD1257 rpL25, - HD1249 HD1254 maeB, - HD1247 HD1246 rec2, - HD1256 HD1248 dgkA, - HD1253 ushA, - HD1250 cpdB,ushA, - HD1251 queA, - HD1257 rpL25, - HD1249 HD1254 maeB, - HD1247 HD1246 rec2, - HD1256 HD1248 ushA, - HD1250 cpdB,ushA, - HD1251 queA, - HD1257 HD1252 dgkA, - HD1253 HD1252 rpL25, - HD1249 HD1254 maeB, - HD1247 HD1246 rec2, - HD1256
* Calculated from Protein Sequence

Gene ID: HD1253

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dgkA  

Definition:
diacylglycerol kinase

Gene Start:
1017916

Gene Stop:
1017557

Gene Length:
360

Molecular Weight*:
13185

pI*:
7.50

Net Charge*:
0.23

EC:
2.7.1.107  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Secondary Evidence:
Lightner,V.A., Bell,R.M. and Modrich,P.
The DNA sequences encoding plsB and dgk loci of Escherichia coli. J. Biol. Chem. 258(18): 10856-10861, 1983.
Medline: 83291031.

Loomis,C.R., Walsh,J.P. and Bell,R.M.
sn-1,2-Diacylglycerol kinase of Escherichia coli. Purification, reconstitution, and partial amino- and carboxyl-terminal analysis. J. Biol. Chem. 260(7): 4091-4097,1985.
Medline: 85157563.

Smith,R.L., O"Toole,J.F., Maguire,M.E. and Sanders,C.R. 2nd. Membrane topology of Escherichia coli diacylglycerol kinase.
J. Bacteriol. 176(17): 5459-5465, 1994.
Medline: 94350829.

Comment:
0

Blast Summary:  PSI-Blast Search
significant hits to diacylglycerol kinases from E. coli (125321), H. influenzae (1170635), Neisseria meningitidis (7226805), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. pneumoniae, or M. genitalium.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0818
COG name: Diacylglycerol kinase
Functional Class:  M
The phylogenetic pattern of COG0818 is ------vceb-huj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000829 (Prokaryotic diacylglycerol kinase) with a combined E-value of 2.5e-49.
    IPB000829A    11-55
    IPB000829B    56-102


ProDom Summary:  Protein Domain Search
Residues 11-118 are 58% similar to a (KINASE DIACYLGLYCEROL PROTEOME COMPLETE) protein domain (PD010722) which is seen in KDGL_ECOLI.



Paralogs:  Local Blast Search

HD1253 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 119 (E-value = 2.8e-44) place HD1253 in the DAGK_prokar family which is described as Prokaryotic diacylglycerol kinase (PF01219)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKPENKANFQRIIRAMGYSMKGLKSTYIYEAAFRQELGLAIIFIPLGFYL
GDTAIEKVLLVGSTLLVLIVELLNSAVEAVVDRIGSEYHELSGRAKDIGS
AAVFVTMLLFAITWLLLIF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACCTGAAAATAAAGCTAATTTCCAACGCATTATTAGAGCAATGGG
GTATTCTATGAAAGGCTTAAAAAGCACCTATATTTATGAAGCTGCTTTTC
GCCAAGAACTTGGATTAGCCATAATATTTATACCGCTTGGTTTTTACTTA
GGCGATACAGCTATCGAAAAAGTGTTATTAGTCGGTTCAACCTTATTAGT
GTTAATCGTAGAATTATTAAATAGTGCTGTTGAAGCCGTGGTCGATCGGA
TTGGTTCAGAATACCATGAGCTTTCTGGTAGGGCAAAAGACATTGGCTCT
GCCGCAGTTTTTGTAACTATGCTGTTATTTGCAATAACTTGGTTATTGCT
AATTTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy