Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR913 IGR911 IGR919 IGR914 IGR915 IGR918 IGR916 IGR917 IGR912 HD1248 dgkA, - HD1253 ushA, - HD1250 cpdB,ushA, - HD1251 queA, - HD1257 rpL25, - HD1249 HD1254 maeB, - HD1247 citG,citX, - HD1245 HD1246 rec2, - HD1256 HD1248 dgkA, - HD1253 ushA, - HD1250 cpdB,ushA, - HD1251 queA, - HD1257 rpL25, - HD1249 HD1254 maeB, - HD1247 citG,citX, - HD1245 HD1246 rec2, - HD1256 HD1248 ushA, - HD1250 cpdB,ushA, - HD1251 queA, - HD1257 HD1252 dgkA, - HD1253 HD1252 rpL25, - HD1249 HD1254 maeB, - HD1247 citG,citX, - HD1245 HD1246 rec2, - HD1256
* Calculated from Protein Sequence

Gene ID: HD1251

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
cpdB  ushA  

Definition:
UDP-sugar hydrolase, 5'nucleotidase/5'-nucleotidase/2',3'-cyclic phosphodiesterase

Gene Start:
1017487

Gene Stop:
1016762

Gene Length:
726

Molecular Weight*:
26671

pI*:
6.00

Net Charge*:
-3.60

EC:
3.1.3.5  3.6.1.45  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  
Purines, pyrimidines, nucleosides, and nucleotides; Sugar-nucleotide biosynthesis and conversions  

Pathway: pathway table
Lipopolysaccharide biosynthesis
Nicotinate and nicotinamide metabolism
Purine metabolism
Pyrimidine metabolism

Secondary Evidence:
Burns,D.M. and Beacham,I.R.
Nucleotide sequence and transcriptional analysis of the E. coli ushA gene, encoding periplasmic UDP-sugar hydrolase (5'-nucleotidase): regulation of the ushA gene, and the signal sequence of its encoded protein product.
Nucleic Acids Res. 14(10): 4325-4342. 1986.
Medline: 86232561.



Comment:
See HD1250.

Blast Summary:  PSI-Blast Search
Numerous significant hits to UshA precursor (UDP-sugar hydrolase, 5'nucleotidase) from E. coli (2506086, 757842), Salmonella enterica (6176417, 6176422), among others.

HD1251 is similar to 5'-nucleotidase from T. pallidum (TP0104).
No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, M. pneumoniae, or M. genitalium.


COGS Summary:  COGS Search
BeTs to 9 clades of COG0737
COG name: 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases
Functional Class:  F
The phylogenetic pattern of COG0737 is a-t-yqvCEB-Huj---l---
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002224 (5'-Nucleotidase) with a combined E-value of 3e-35.
    IPB002224A    27-45
    IPB002224B    71-79
    IPB002224C    102-121
    IPB002224D    128-137
    IPB002224E    205-214


ProDom Summary:  Protein Domain Search
Residues 7-83 are 51% similar to a (SIGNAL HYDROLASE PRECURSOR) protein domain (PD364042) which is seen in Q9KQ30_VIBCH.

Residues 109-237 are 73% similar to a (HYDROLASE COMPLETE PROTEOME PRECURSOR SIGNAL UDP-SUGAR) protein domain (PD002576) which is seen in Q9CLM8_PASMU.

Residues 7-83 are 66% similar to a (HYDROLASE UDP-SUGAR PRECURSOR SIGNAL) protein domain (PD357434) which is seen in USHA_ECOLI.

Residues 147-214 are 47% similar to a (PROTEOME COMPLETE HYDROLASE) protein domain (PD267733) which is seen in O34313_BACSU.



Paralogs:  Local Blast Search
HD1251 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 29 to 240 (E-value = 2.4e-09) place HD1251 in the Metallophos family which is described as Calcineurin-like phosphoesterase (PF00149)

PDB Hit:
pdb|2USH|B Chain B, 5'-Nucleotidase From E. Coli >gi|5542500|pd... 301 5e-083

Gene Protein Sequence:
MKFNKTLLTIALCASSSIMAYQQDKDYSFTVLHTNDIHGHFWNNEKGEFG
LAAQKTLIDQIKKEVEAKGGSTIILNAGDINTGVPESDLQNARPDYEGLN
AIGYEAMVLGNHEFDFPLPILTMQEKWAKFPLISANVFNKATKKELVDPY
IMLDKQGLKIAVMGLTTEDTAKVGNPDVTENVLFKDPIKTAKTMLANINE
KEKPDVRIALTHMGWYLDGKHGTNAPGDVTMARSLDKVLLT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTCAATAAAACACTCCTTACCATAGCACTTTGTGCTTCTAGTTC
AATAATGGCTTATCAGCAAGATAAAGATTATTCATTTACTGTATTGCATA
CTAACGATATTCACGGCCATTTCTGGAATAATGAAAAAGGGGAATTTGGC
CTTGCCGCACAAAAAACACTAATCGATCAGATTAAAAAAGAAGTTGAAGC
AAAAGGTGGCTCGACTATCATTTTAAACGCTGGTGATATTAATACGGGAG
TCCCAGAATCAGATTTACAAAATGCTCGTCCAGATTATGAAGGATTAAAT
GCGATTGGCTATGAAGCAATGGTACTAGGCAACCACGAATTTGATTTCCC
TTTACCAATATTAACTATGCAAGAAAAATGGGCTAAATTTCCGTTGATTT
CTGCTAATGTATTTAACAAAGCGACAAAAAAAGAATTAGTTGATCCTTAT
ATTATGTTAGATAAACAAGGCTTAAAAATAGCTGTTATGGGATTAACGAC
TGAAGACACGGCTAAAGTAGGCAATCCTGATGTTACTGAAAATGTCCTTT
TTAAGGATCCAATTAAAACAGCTAAAACGATGTTAGCTAACATTAATGAA
AAAGAAAAACCGGATGTCCGAATTGCATTAACACATATGGGCTGGTACTT
AGATGGCAAACATGGTACCAATGCACCGGGTGATGTCACTATGGCAAGAA
GCCTTGATAAAGTACTTTTGACTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy