Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR913 IGR911 IGR914 IGR915 IGR918 IGR916 IGR917 IGR912 HD1248 dgkA, - HD1253 ushA, - HD1250 cpdB,ushA, - HD1251 rpL25, - HD1249 HD1254 maeB, - HD1247 citG,citX, - HD1245 HD1246 rec2, - HD1256 HD1248 dgkA, - HD1253 ushA, - HD1250 cpdB,ushA, - HD1251 rpL25, - HD1249 HD1254 maeB, - HD1247 citG,citX, - HD1245 HD1246 rec2, - HD1256 HD1248 ushA, - HD1250 cpdB,ushA, - HD1251 HD1252 dgkA, - HD1253 HD1252 rpL25, - HD1249 HD1254 maeB, - HD1247 citG,citX, - HD1245 HD1246 rec2, - HD1256
* Calculated from Protein Sequence

Gene ID: HD1250

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ushA  

Definition:
UshA precursor (UDP-sugar hydrolase)

Gene Start:
1016549

Gene Stop:
1015845

Gene Length:
705

Molecular Weight*:
26268

pI*:
5.90

Net Charge*:
-2.27

EC:
3.1.3.5  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Sugar-nucleotide biosynthesis and conversions  

Pathway: pathway table
Nicotinate and nicotinamide metabolism
Purine metabolism
Pyrimidine metabolism

Primary Evidence:
NULL

Secondary Evidence:
Tamao,Y., Noguchi,K., Sakai-Tomita,Y., Hama,H., Shimamoto,T., Kanazawa,H., Tsuda,M. and Tsuchiya,T.
Sequence analysis of nutA gene encoding membrane-bound Cl(-)-dependent 5"-nucleotidase of Vibrio parahaemolyticus.
J. Biochem. 109(1): 24-29, 1991.
Medline: 91201280.

Burns,D.M. and Beacham,I.R.
Nucleotide sequence and transcriptional analysis of the E. coli
ushA gene, encoding periplasmic UDP-sugar hydrolase
(5'-nucleotidase): regulation of the ushA gene, and the signal
sequence of its encoded protein product
Nucleic Acids Res. 14 (10), 4325-4342 (1986)
MEDLINE: 86232561


Comment:
See HD1251.

Blast Summary:  PSI-Blast Search
Many significant hits to UshA precursor (UDP-sugar hydrolase, 5"nucleotidase) from E. coli (2506086), Vibrio parahaemolyticus (), H. influenzae (), Neisseria meningitidis (), among others.

HD is similar to 5"-nucleotidase from T. pallidum (TP0104).
No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, M. pneumoniae, or M. genitalium.


COGS Summary:  COGS Search
BeTs to 6 clades of COG0737
COG name: 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases
Functional Class:  F
The phylogenetic pattern of COG0737 is a-t-yqvCEB-Huj---l---
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002224 (5'-Nucleotidase) with a combined E-value of 3.7e-31.
    IPB002224F    53-68
    IPB002224G    84-95
    IPB002224H    98-114
    IPB002224I    167-190


ProDom Summary:  Protein Domain Search
Residues 196-234 are 84% similar to a (HYDROLASE UDP-SUGAR PRECURSOR SIGNAL) protein domain (PD025250) which is seen in Q9CLM8_PASMU.

Residues 46-194 are 69% similar to a (HYDROLASE PRECURSOR COMPLETE PROTEOME) protein domain (PD302725) which is seen in Q9CLM8_PASMU.

Residues 1-44 are 56% similar to a (HYDROLASE UDP-SUGAR PRECURSOR SIGNAL) protein domain (PD360740) which is seen in Q9CLM8_PASMU.



Paralogs:  Local Blast Search
HD1250 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 45 to 195 (E-value = 4.8e-49) place HD1250 in the 5_nucleotid_C family which is described as 5'-nucleotidase, C-terminal domain (PF02872)

PDB Hit:
pdb|2USH|B Chain B, 5'-Nucleotidase From E. Coli >gi|5542500|pd... 216 2e-057

Gene Protein Sequence:
LKKTITTADGKKEYQLYQNEIKPDPALYEQLEKYQDDGDKLLNIYVGEVK
GLLDGDRNHVRFHQTNLGRLIAQSQKERVKADIGIVNSGGVRASIEEGKI
TYRTILTVQPFGNMIATIDLKGQEFIDFLTAVALKEVDTGAYPQFAGISM
VVDRTAKQISDLKINGQAFDPNTSYKISIPDYLTAGGDGYPVMKKHPTYV
NTGFIDAEMLKKYFEENKVIEASMFDPKQDIIFK$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAAAAAAACAATAACAACAGCAGACGGTAAAAAAGAATATCAATTATA
CCAAAATGAAATTAAACCGGATCCCGCATTATATGAACAGTTAGAAAAAT
ACCAAGATGATGGAGATAAATTGCTGAATATTTATGTTGGCGAAGTTAAA
GGCTTATTAGATGGTGATCGTAATCACGTACGCTTCCACCAAACTAACTT
AGGCCGATTAATCGCTCAATCACAAAAAGAACGTGTAAAAGCTGATATTG
GTATTGTAAATTCTGGCGGTGTTCGTGCTTCTATTGAAGAAGGCAAAATT
ACTTACAGAACAATTCTAACTGTTCAGCCATTTGGCAATATGATCGCAAC
AATTGATCTAAAAGGGCAAGAATTTATTGATTTTCTAACTGCTGTGGCTT
TAAAAGAAGTAGATACTGGTGCTTACCCTCAATTTGCAGGCATCTCAATG
GTCGTAGATCGTACAGCAAAACAGATTTCAGACCTTAAGATTAATGGCCA
AGCATTTGATCCAAACACAAGCTATAAAATTTCTATTCCAGATTATTTAA
CCGCTGGCGGAGATGGTTATCCTGTTATGAAAAAACATCCAACTTATGTA
AACACTGGTTTTATTGATGCTGAAATGTTAAAAAAATACTTTGAAGAAAA
TAAAGTCATTGAAGCAAGTATGTTTGATCCAAAACAAGATATTATCTTTA
AATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy