Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR913 IGR911 IGR910 IGR914 IGR915 IGR918 IGR916 IGR917 IGR912 HD1248 dgkA, - HD1253 ushA, - HD1250 cpdB,ushA, - HD1251 rpL25, - HD1249 HD1254 maeB, - HD1247 citG,citX, - HD1245 HD1246 citF,cilA, - HD1243 rec2, - HD1256 HD1248 dgkA, - HD1253 ushA, - HD1250 cpdB,ushA, - HD1251 rpL25, - HD1249 HD1254 maeB, - HD1247 citG,citX, - HD1245 HD1246 citF,cilA, - HD1243 rec2, - HD1256 HD1248 ushA, - HD1250 cpdB,ushA, - HD1251 HD1252 dgkA, - HD1253 HD1252 rpL25, - HD1249 HD1254 maeB, - HD1247 citG,citX, - HD1245 HD1246 citF,cilA, - HD1243 rec2, - HD1256
* Calculated from Protein Sequence

Gene ID: HD1247

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
maeB  

Definition:
NADP-dependent malic enzyme (NADP-ME)

Gene Start:
1014007

Gene Stop:
1015275

Gene Length:
1269

Molecular Weight*:
44944

pI*:
5.40

Net Charge*:
-5.44

EC:
1.1.1.38  1.1.1.40  

Functional Class:
Energy metabolism; TCA cycle  

Pathway: pathway table
Carbon fixation
Pyruvate metabolism

Secondary Evidence:
Iwakura,M., Hattori,J., Arita,Y., Tokushige,M. and Katsuki,H. Studies on regulatory functions of malic enzymes. VI. Purification and molecular properties of NADP-linked malic enzyme from Escherichia coli W.
J. Biochem. 85(5): 1355-1365, 1979.
Medline: 79193995.

Comment:
0

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to NADP-dependent malic enzyme (NADP-ME) from H. influenzae (1170873), E. coli (1799887, 6685630), Neisseria meningitidis (7225897), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. pneumoniae, or M. genitalium.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0281
COG name: Malic enzyme
Functional Class:  C
The phylogenetic pattern of COG0281 is a--ky-vcEBrh--------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002505 (Phosphate acetyl/butaryl transferase) with a combined E-value of 3e-13.
    IPB002505A    65-99
***** IPB001891 (Malic enzymes) with a combined E-value of 2.1e-10.
    IPB001891E    136-186
    IPB001891G    213-224
    IPB001891J    308-342


ProDom Summary:  Protein Domain Search
Residues 9-67 are 83% similar to a (OXIDOREDUCTASE ENZYME PROTEOME COMPLETE) protein domain (PD005834) which is seen in MAO2_HAEIN.

Residues 68-114 are 89% similar to a (ENZYME OXIDOREDUCTASE COMPLETE PROTEOME) protein domain (PD338824) which is seen in Q9K0D8_NEIMB.

Residues 114-210 are 39% similar to a (NAD OXIDOREDUCTASE MALIC ENZYME) protein domain (PD395781) which is seen in MAO1_BACSU.

Residues 116-388 are 57% similar to a (OXIDOREDUCTASE ENZYME MALIC MALATE NADP NADP-DEPENDENT) protein domain (PD001213) which is seen in MAO1_BACSU.



Paralogs:  Local Blast Search

HD1247 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 18 to 160 (E-value = 9.7e-80) place HD1247 in the malic family which is described as Malic enzyme, N-terminal domain (PF00390)
Residues 162 to 398 (E-value = 2e-118) place HD1247 in the Malic_M family which is described as Malic enzyme, NAD binding domain (PF03949)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MGDLKQAALDFHEFPIPGKISVTPTKSLKTQHDLALAYSPGVAEPCLAIE
KDPSTARRYTAKGNLVAVISNGTAVLGLGNIGALASKPVMEGKGVLFKKF
AGIDVFDIEINEQDPDKLIDIIASLEPTFGGINLEDIKAPECFYIEQKLR
ERMGIPVFHDDQHGTAIIVGAAVLNGLQIVGKSLDQVRLVVNGAGASAIA
CTNLLCSLGIKKENITMCDSKGIIFKGRGDQIDQTKQAYAIVDNGWRTLS
DAINGADVFLGCSKAGALTQAMVKKMAKDPLILALANPVPEITPDEVKQA
RLDAIVCTGRSDYRNQVNNVLCFPFLFRGALDVGATEINEEMKIAAAKAI
ADLAKQPVSLEVLSTYGELSFGPEYIIPMPFDPRLIVEVSTAVAKAAMAS
GVATRPISDCAVYAEKLKTLLA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTGATTTAAAACAAGCAGCATTAGATTTTCATGAATTCCCAATACC
AGGTAAAATTTCAGTTACACCAACCAAATCTCTCAAAACTCAGCATGATT
TAGCTTTAGCTTATTCACCTGGTGTAGCAGAGCCTTGTTTAGCGATTGAA
AAAGATCCATCTACTGCTCGTCGTTACACGGCAAAAGGCAATTTAGTTGC
GGTTATTTCAAATGGTACAGCCGTGTTAGGTTTAGGTAATATTGGTGCAT
TAGCATCTAAACCCGTGATGGAAGGCAAAGGCGTATTATTTAAAAAATTC
GCGGGCATTGATGTGTTTGATATTGAAATTAATGAACAAGATCCAGATAA
ACTCATTGATATTATAGCCTCGCTAGAACCAACATTTGGTGGTATTAATC
TTGAAGATATTAAAGCACCAGAATGTTTTTATATTGAGCAGAAATTACGT
GAGCGAATGGGGATCCCGGTATTCCATGATGATCAACATGGAACAGCCAT
TATTGTTGGCGCAGCGGTGTTAAATGGTTTACAAATTGTAGGTAAATCGC
TTGATCAAGTGCGTTTGGTTGTGAATGGCGCGGGTGCATCAGCCATTGCC
TGTACTAATTTATTATGTTCTCTGGGAATTAAAAAAGAAAATATTACGAT
GTGTGATTCAAAAGGTATTATTTTCAAAGGCCGTGGCGATCAGATCGATC
AAACCAAACAAGCTTATGCGATAGTAGATAATGGTTGGAGAACGTTGTCA
GATGCAATTAATGGTGCGGATGTTTTCTTAGGCTGTTCAAAAGCAGGCGC
ATTAACACAGGCAATGGTTAAAAAAATGGCGAAAGATCCGCTTATTCTTG
CATTAGCTAATCCCGTGCCAGAAATAACACCTGATGAAGTAAAACAAGCA
CGTTTAGATGCTATTGTTTGTACAGGTCGTTCAGATTATCGTAATCAAGT
AAATAATGTACTGTGTTTTCCATTCTTATTTAGAGGAGCCTTAGATGTTG
GGGCAACCGAGATTAATGAAGAAATGAAAATAGCTGCAGCCAAAGCAATT
GCTGATTTAGCAAAACAACCGGTATCTCTAGAAGTATTATCTACGTATGG
TGAGCTATCATTTGGCCCTGAATATATTATTCCAATGCCATTTGATCCAC
GCTTGATTGTTGAGGTATCTACGGCAGTGGCTAAAGCGGCAATGGCATCA
GGTGTTGCTACTCGTCCAATTTCAGATTGTGCTGTTTATGCAGAAAAGCT
AAAAACATTGTTAGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy