Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR906 IGR911 IGR909 IGR910 IGR908 IGR905 IGR907 IGR912 HD1239 lolA, - HD1237 citE,cilB, - HD1242 rimK, - HD1238 citC, - HD1240 maeB, - HD1247 citG,citX, - HD1245 HD1246 citF,cilA, - HD1243 HD1239 lolA, - HD1237 citE,cilB, - HD1242 rimK, - HD1238 citC, - HD1240 maeB, - HD1247 citG,citX, - HD1245 HD1246 citF,cilA, - HD1243 HD1239 citE,cilB, - HD1242 rimK, - HD1238 citC, - HD1240 maeB, - HD1247 citG,citX, - HD1245 HD1246 citF,cilA, - HD1243 citD, - HD1241 citD, - HD1241 lolA, - HD1237
* Calculated from Protein Sequence

Gene ID: HD1243

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
citF  cilA  

Definition:
citrate lyase alpha chain (citrase)

Gene Start:
1009345

Gene Stop:
1010847

Gene Length:
1503

Molecular Weight*:
53887

pI*:
6.70

Net Charge*:
-1.74

EC:
2.8.3.10  4.1.3.6  

Functional Class:
Energy metabolism; TCA cycle  

Pathway: pathway table
Citrate cycle (TCA cycle)
Reductive carboxylate cycle (CO2 fixation)

Primary Evidence:
NULL

Secondary Evidence:
Bott,M. and Dimroth,P.
Klebsiella pneumoniae genes for citrate lyase and citrate lyase ligase: localization, sequencing, and expression.
Mol. Microbiol. 14(2): 347-356, 1994.
Medline: 95131756.



Comment:
0

Blast Summary:  PSI-Blast Search
Some strong significant hits using gapped BLAST to citrate lyase alpha chain (citrase) CilA from H. influenzae (1168950), E. coli (2498238, 1778532), Klebsiella pneumoniae (1168951), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. pneumoniae, or M. genitalium.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1243 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MIIREQRVEKFNAGKAVYQSVSKTESLARTAKDRKICANLEEAIRRSGLK
DGMTVSFHHAFRAGDCVVNMVMNKIAEMGFKNLTLASSSLIDSHYPLIEH
IKNGVVTKIYSSGLRGQLADEISRGLLAEPVNIHSHGGRVHLIKAGELKI
DVAFLGVPCCDKFGNANGFSGKSKCGSLGYARIDAEYADKVVLLTEQFDE
YPLNPISIGQDNVDLIVQVDEVGDPEKIGGGATRMTTNPRELLIARKCAQ
VIFASGYFKDGFSLQTGTGGASLAVTRFLEDKMRREQITAGFALGGITSS
IVALHEAGLIKKLIDVQSFDKDAAESLARNPNHIEVSANQYANYSSKGPS
VECLDIVVLSALEIDTQFNVNVLTGSDGVIRGASGGHSDTAASAQVAIIV
APLVRGRIPTVVEQVITCVTPGENIDILVTDHGVAVNPKRLDLVDKLTAA
GLELFTIEQLCARAYSITGKSKEIEFKDKPVAVVRYRDGSVIDTVYQIKE
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAATAAGAGAACAACGTGTTGAAAAATTTAATGCAGGTAAAGCAGT
TTATCAATCAGTATCCAAAACAGAATCTCTTGCTCGTACTGCTAAAGATC
GCAAAATTTGCGCTAATTTGGAAGAGGCTATCCGCCGTTCAGGATTAAAA
GATGGCATGACCGTATCTTTCCACCATGCTTTTCGTGCTGGCGATTGTGT
TGTGAATATGGTCATGAATAAAATTGCTGAAATGGGGTTTAAAAACTTAA
CGCTAGCATCTAGTTCATTGATTGACAGCCATTACCCGCTGATTGAACAC
ATTAAAAATGGTGTCGTAACTAAAATTTATTCATCTGGTTTACGGGGGCA
GTTAGCTGATGAAATATCAAGAGGGCTTTTAGCAGAGCCGGTTAATATCC
ATTCTCATGGCGGTAGAGTACATTTAATTAAAGCGGGCGAATTAAAGATC
GATGTTGCTTTTTTAGGCGTGCCTTGTTGCGATAAATTTGGTAATGCAAA
TGGTTTTAGCGGTAAAAGTAAATGCGGTTCATTAGGTTATGCTCGTATTG
ATGCAGAATATGCAGATAAAGTGGTGTTATTAACGGAGCAGTTCGATGAA
TATCCACTAAATCCAATCAGTATTGGTCAAGATAACGTTGATTTGATTGT
ACAAGTTGATGAAGTGGGCGATCCGGAAAAAATCGGTGGTGGTGCCACGC
GTATGACGACAAATCCTCGCGAATTATTAATTGCGCGTAAATGTGCGCAA
GTGATTTTCGCTTCAGGCTATTTCAAAGATGGTTTTTCATTACAAACGGG
TACCGGTGGAGCATCATTAGCGGTAACGCGTTTTCTTGAAGATAAAATGC
GCCGTGAGCAGATTACCGCAGGGTTTGCTTTAGGAGGCATTACTTCAAGC
ATTGTGGCATTACACGAAGCGGGCTTAATTAAGAAATTAATTGATGTGCA
ATCCTTTGATAAAGATGCGGCAGAATCTTTAGCTCGTAATCCAAATCATA
TCGAAGTGAGTGCTAATCAATACGCTAACTATAGTTCAAAAGGCCCGTCT
GTTGAATGTTTAGATATTGTTGTACTGTCTGCCTTAGAAATTGATACTCA
ATTTAATGTTAATGTATTAACTGGATCTGATGGTGTTATTCGAGGCGCTT
CTGGCGGCCATTCTGATACGGCTGCTTCAGCGCAAGTAGCCATTATTGTT
GCACCGCTTGTTCGTGGTCGTATTCCCACTGTTGTAGAACAGGTGATTAC
TTGTGTTACACCGGGTGAGAATATCGATATCCTTGTGACAGATCATGGTG
TGGCGGTTAATCCTAAACGGTTAGATTTAGTCGATAAATTGACCGCTGCC
GGGCTTGAACTATTTACTATTGAGCAACTTTGTGCACGTGCATATAGCAT
TACCGGTAAATCAAAAGAAATTGAGTTTAAGGATAAGCCGGTTGCAGTGG
TTCGTTATCGTGATGGTTCTGTAATCGATACAGTTTACCAAATAAAAGAA
TAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy