Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR906 IGR911 IGR909 IGR910 IGR908 IGR904 IGR905 IGR907 IGR912 HD1239 lolA, - HD1237 citE,cilB, - HD1242 rimK, - HD1238 citC, - HD1240 citG,citX, - HD1245 HD1246 citF,cilA, - HD1243 polA, - HD1236 HD1239 lolA, - HD1237 citE,cilB, - HD1242 rimK, - HD1238 citC, - HD1240 citG,citX, - HD1245 HD1246 citF,cilA, - HD1243 polA, - HD1236 HD1239 lolA, - HD1237 citE,cilB, - HD1242 rimK, - HD1238 citC, - HD1240 citG,citX, - HD1245 HD1246 citF,cilA, - HD1243 polA, - HD1236 citD, - HD1241 citD, - HD1241
* Calculated from Protein Sequence

Gene ID: HD1242

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
citE  cilB  

Definition:
citrate lyase beta chain

Gene Start:
1008431

Gene Stop:
1009333

Gene Length:
903

Molecular Weight*:
32669

pI*:
5.00

Net Charge*:
-7.44

EC:
4.1.3.34  4.1.3.6  

Functional Class:
Energy metabolism; Fermentation  
Energy metabolism; TCA cycle  

Pathway: pathway table
Citrate cycle (TCA cycle)
Reductive carboxylate cycle (CO2 fixation)

Secondary Evidence:
Hupperich,M., Henschen,A. and Eggerer,H.
Citrate lyase from Klebsiella pneumoniae. The complete primary structure of the acyl lyase subunit.
Eur. J. Biochem. 192(1): 161-166, 1990.
Medline: 90382437.

Bott,M. and Dimroth,P.
Klebsiella pneumoniae genes for citrate lyase and citrate lyase ligase: localization,
sequencing, and expression.
Mol. Microbiol. 14(2): 347-356, 1994.
Medline: 95131756.


Comment:


Blast Summary:  PSI-Blast Search
Several strong significant hits using gapped BLAST to citrate lyase beta chain CilB (acyl lyase subunit) from H. influenzae (1168952), E. coli (3287961, 7465802), (), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. pneumoniae, or M. genitalium.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 180-300 are 76% similar to a (LYASE BETA CITRATE COMPLETE) protein domain (PD008620) which is seen in CILB_HAEIN.

Residues 11-170 are 87% similar to a (LYASE BETA CITRATE COMPLETE) protein domain (PD341260) which is seen in CILB_HAEIN.



Paralogs:  Local Blast Search
HD1242 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LGENIMSQPIKLRRSMLFVPGSNAAMISNTFIYKPDAIMFDLEDAVALKE
KDSARILVAHALQHPLYQNIECVVRVNPLDSEFGIADLNAVVRAGVDVVR
MPKTETAQDVIEMDKVITDIELACGRACGSTKMLAAIESPLGITQANQIA
VASKRLIGIALGAEDYVRNLKTERSPEGIELLFARCAILQAARAAGIQAF
DTVYSDANNEEGFLKEAALIKQLGFDGKSLINPRQIELLHNLFAPTQKEV
DQAQKIIDAADEAFQQGLGVASLNGKMIDAPIIERARLVLERAKSGIREE
$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGGAGAAAATATTATGAGCCAGCCGATAAAATTAAGAAGAAGTATGCT
TTTTGTGCCAGGTTCTAATGCCGCAATGATAAGTAATACATTTATTTATA
AACCTGATGCAATTATGTTTGATTTAGAAGATGCCGTGGCACTGAAAGAA
AAAGATTCAGCACGGATCTTAGTTGCGCATGCATTACAACATCCGCTTTA
TCAAAATATTGAGTGTGTTGTGCGTGTAAACCCGTTGGATTCTGAATTTG
GTATAGCAGATTTAAATGCAGTGGTGAGAGCCGGCGTAGATGTGGTGCGT
ATGCCAAAAACTGAAACCGCACAAGATGTAATTGAAATGGATAAGGTTAT
TACGGACATAGAGTTGGCCTGTGGTAGAGCTTGTGGTTCGACTAAAATGT
TAGCAGCGATAGAATCGCCATTAGGTATTACGCAAGCAAATCAAATTGCA
GTAGCTTCTAAACGTTTAATTGGGATTGCATTAGGTGCTGAAGATTATGT
GCGTAATTTAAAAACGGAGCGTTCGCCTGAGGGAATCGAATTACTTTTTG
CGCGTTGTGCTATTTTACAAGCCGCTCGTGCAGCGGGTATTCAAGCATTT
GATACAGTTTATTCAGATGCTAATAATGAAGAAGGTTTCCTCAAAGAAGC
TGCTTTGATTAAACAATTAGGCTTTGATGGTAAATCATTAATTAATCCTC
GCCAAATCGAATTGTTACATAATTTATTTGCACCAACTCAAAAAGAGGTT
GATCAGGCTCAGAAAATTATTGATGCAGCTGATGAGGCATTCCAACAAGG
ATTAGGTGTTGCTTCATTAAATGGCAAAATGATAGATGCACCCATTATCG
AGCGTGCAAGACTGGTGCTTGAGCGTGCGAAATCAGGGATTCGAGAAGAG
TAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy