Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR906 IGR911 IGR909 IGR910 IGR908 IGR904 IGR905 IGR907 HD1239 lolA, - HD1237 citE,cilB, - HD1242 rimK, - HD1238 citC, - HD1240 citG,citX, - HD1245 HD1246 citF,cilA, - HD1243 polA, - HD1236 HD1239 lolA, - HD1237 citE,cilB, - HD1242 rimK, - HD1238 citC, - HD1240 citG,citX, - HD1245 HD1246 citF,cilA, - HD1243 polA, - HD1236 HD1239 lolA, - HD1237 citE,cilB, - HD1242 rimK, - HD1238 citC, - HD1240 citG,citX, - HD1245 HD1246 citF,cilA, - HD1243 polA, - HD1236 citD, - HD1241 citD, - HD1241
* Calculated from Protein Sequence

Gene ID: HD1241

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
citD  

Definition:
citrate lyase acyl carrier protein (gamma chain)

Gene Start:
1008147

Gene Stop:
1008449

Gene Length:
303

Molecular Weight*:
10816

pI*:
4.50

Net Charge*:
-4.06

EC:
4.1.3.6  

Functional Class:
Energy metabolism; TCA cycle  

Pathway: pathway table
Citrate cycle (TCA cycle)
Reductive carboxylate cycle (CO2 fixation)

Secondary Evidence:
Martin,M., Corrales,M.A., de Mendoza,D., Lopez,P. and Magni,C. Cloning and molecular characterization of the citrate utilization citMCDEFGRP cluster of Leuconostoc paramesenteroides.
FEMS Microbiol. Lett. 174(2): 231-238, 1999.
Medline: 99271171.

Bott,M. and Dimroth,P.
Klebsiella pneumoniae genes for citrate lyase and citrate lyase ligase: localization,
sequencing, and expression.
Mol. Microbiol. 14(2): 347-356, 1994.
Medline: 95131756.

Comment:
0

Blast Summary:  PSI-Blast Search
Few significant hits using gapped BLAST to citrate lyase acyl carrier protein (citrate lyase gamma chain) from H. influenzae (1168954), E. coli (2498240), Weissella paramesenteroides (6249492), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. pneumoniae, or M. genitalium.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 6-97 are 59% similar to a (LYASE CITRATE GAMMA ACYL) protein domain (PD015389) which is seen in CILG_HAEIN.



Paralogs:  Local Blast Search
HD1241 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 99 (E-value = 2.3e-49) place HD1241 in the CitD family which is described as Citrate lyase, gamma subunit (PF04953)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKEIIMQITKTAVAGTLESSDVQIRIAPSTTMDIEINSSVAKQFGEDILN
SVTAVLAQFEVSSAQIIIEDKGALDCVLRARLKAALLRATDEALAWEKIL
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGGAAATTATTATGCAAATAACGAAAACAGCAGTAGCTGGCACACT
AGAATCTAGTGATGTACAGATACGTATTGCACCATCAACTACGATGGATA
TTGAAATCAATAGCTCAGTAGCAAAACAATTTGGTGAGGATATTTTAAAT
TCAGTAACTGCTGTATTAGCACAATTTGAGGTCAGCTCAGCACAAATTAT
TATAGAAGATAAAGGTGCATTAGATTGTGTATTACGTGCTCGTTTAAAAG
CCGCTTTGTTGCGTGCAACAGATGAAGCGCTTGCTTGGGAGAAAATATTA
TGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy