Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR906 IGR911 IGR909 IGR910 IGR908 IGR904 IGR905 IGR907 HD1239 lolA, - HD1237 citE,cilB, - HD1242 rimK, - HD1238 citC, - HD1240 citG,citX, - HD1245 HD1246 citF,cilA, - HD1243 polA, - HD1236 HD1239 lolA, - HD1237 citE,cilB, - HD1242 rimK, - HD1238 citC, - HD1240 citG,citX, - HD1245 HD1246 citF,cilA, - HD1243 polA, - HD1236 HD1239 lolA, - HD1237 citE,cilB, - HD1242 rimK, - HD1238 citC, - HD1240 citG,citX, - HD1245 HD1246 citF,cilA, - HD1243 polA, - HD1236 citD, - HD1241 citD, - HD1241
* Calculated from Protein Sequence

Gene ID: HD1240

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
citC  

Definition:
citrate lyase ligase/acetate:SH-citrate lyase ligase (AMP)

Gene Start:
1007087

Gene Stop:
1008103

Gene Length:
1017

Molecular Weight*:
38610

pI*:
6.90

Net Charge*:
-0.72

EC:
6.2.1.22  

Functional Class:
Energy metabolism; TCA cycle  

Pathway: pathway table

Secondary Evidence:
Bott M, Dimroth P.
Klebsiella pneumoniae genes for citrate lyase and citrate lyase ligase: localization, sequencing, and expression.
Mol Microbiol. 1994 Oct;14(2):347-56.
PMID: 7830578

Comment:
0

Blast Summary:  PSI-Blast Search
Few significant hits using gapped BLAST to citrate (pro-3S)-lyase ligase (citrate lyase synthetase) from H. influenzae (1168960), E. coli (2498241, 4062235), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. pneumoniae, or M. genitalium.

COGS Summary:  COGS Search
BeTs to 4 clades of COG0669
COG name: Phosphopantetheine adenylyltransferase
Functional Class:  H
The phylogenetic pattern of COG0669 is -----qvcebrhuj--ol---
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 3-331 are 65% similar to a (LIGASE LYASE CITRATE PRO-3S-LYASE) protein domain (PD016147) which is seen in CITC_HAEIN.



Paralogs:  Local Blast Search
HD1240 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 37 to 108 (E-value = 9.1e-06) place HD1240 in the Acetyltransf_1 family which is described as Acetyltransferase (GNAT) family (PF00583)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MQFERVSIHNHKKMLAVCEFLTKNDLRLDKQVELFIVVYNDTDNIIACGG
LAQNIIKCVAISDVYRGEGIALQLVTELVNVAYEFGRSELFIFTKPEYAL
LFKSCGFYPISTAYPYVVLLENSATRLQKQCLTWQKQAVVATKVGATVMN
ANPFTLGHRYLIEQALAQCDHLHLFVVEEEASQFCYQERFALVQHGIADL
SNITLHPSSQYIISRATFPDYFLKDSHIVDAAYLELDLRLFRQHIAPALA
ITHRFIGTEPFCPVTAEYNRKMHYWLQQAVMEADAINVVEIERKKVSNQA
ISASTVRQLFSERKWQQLLSMVPITTFNFLQKIANEPG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAATTTGAAAGAGTCAGTATTCATAACCATAAAAAGATGCTCGCAGT
ATGTGAGTTTCTTACTAAAAATGACTTGCGGTTAGATAAACAAGTTGAGC
TTTTTATTGTTGTTTATAATGATACGGATAACATAATTGCTTGCGGTGGT
TTAGCACAGAATATCATTAAATGTGTAGCAATTAGTGATGTGTATCGCGG
TGAAGGTATTGCATTACAGCTTGTTACTGAATTGGTTAATGTAGCTTATG
AATTTGGACGCAGTGAGCTTTTTATTTTTACCAAACCTGAGTATGCATTA
TTGTTTAAATCTTGCGGTTTTTATCCTATTTCGACCGCTTATCCTTATGT
TGTGTTACTTGAAAATAGTGCCACTCGTTTGCAAAAGCAATGTTTAACGT
GGCAAAAACAAGCGGTGGTGGCGACAAAAGTGGGGGCAACTGTGATGAAT
GCTAATCCATTCACATTAGGTCACCGATATCTAATTGAACAAGCATTGGC
ACAATGTGATCATTTACACCTTTTTGTTGTGGAAGAAGAGGCATCGCAGT
TTTGCTATCAAGAGCGCTTTGCATTAGTACAACATGGCATTGCTGATTTA
TCCAACATTACTTTACATCCTAGCTCTCAGTATATTATTTCGCGAGCTAC
TTTTCCTGATTACTTCCTTAAAGATAGCCATATTGTTGATGCGGCTTATT
TAGAGCTTGATTTACGGCTATTTCGTCAACATATTGCGCCAGCCTTAGCG
ATTACTCATCGTTTTATCGGAACGGAACCATTCTGCCCAGTAACAGCAGA
ATATAACCGTAAAATGCATTATTGGCTACAACAGGCTGTAATGGAGGCGG
ATGCTATTAATGTAGTTGAAATTGAAAGAAAAAAAGTATCGAATCAAGCG
ATTTCCGCGTCAACGGTTAGGCAACTATTCAGTGAGCGAAAGTGGCAACA
ATTATTATCGATGGTGCCCATCACAACTTTCAATTTTTTGCAAAAAATAG
CAAATGAACCCGGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy