Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR906 IGR909 IGR908 IGR904 IGR905 IGR903 IGR907 HD1239 lolA, - HD1237 citE,cilB, - HD1242 rimK, - HD1238 citC, - HD1240 sapD, - HD1235 citF,cilA, - HD1243 polA, - HD1236 HD1239 lolA, - HD1237 citE,cilB, - HD1242 rimK, - HD1238 citC, - HD1240 sapD, - HD1235 citF,cilA, - HD1243 polA, - HD1236 HD1239 lolA, - HD1237 citE,cilB, - HD1242 rimK, - HD1238 citC, - HD1240 sapD, - HD1235 citF,cilA, - HD1243 polA, - HD1236 citD, - HD1241 citD, - HD1241
* Calculated from Protein Sequence

Gene ID: HD1238

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rimK  

Definition:
ribosomal protein S6 modification protein

Gene Start:
1005194

Gene Stop:
1006111

Gene Length:
918

Molecular Weight*:
33364

pI*:
8.30

Net Charge*:
4.87

EC:
6.3.2.-  

Functional Class:
Translation; Ribosomal proteins: synthesis and modification  

Pathway: pathway table
Tryptophan metabolism
Ubiquinone biosynthesis

Secondary Evidence:
Kang,W.K., Icho,T., Isono,S., Kitakawa,M. and Isono,K. 1989. Characterization of the gene rimK responsible for the addition of glutamic acid residues to the C-terminus of ribosomal protein S6 in. Escherichia coli K12.
Mol. Gen. Genet. 217(2-3): 281-288.
Medline: 89364710.

Comment:
See HD1045 for the predicted rps6 gene.

Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to ribosomal protein S6 modification protein from H. influenzae (1172934), E. coli (2507114, 78837), Sulfolobus solfataricus (6015830), among others.

HD1238 is similar to ribosomal protein S6 modification protein from M. genitalium (MG012) and M. pneumoniae (MP0138). No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, or T. pallidum.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0189
COG name: Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase)
Functional Class: H,J
The phylogenetic pattern of COG0189 is aM-k---cE--h--gp-----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-113 are 54% similar to a (S6 RIBOSOMAL MODIFICATION PROTEOME) protein domain (PD037405) which is seen in Q9CMJ8_PASMU.

Residues 1-281 are 37% similar to a (LIGASE SYNTHETASE CARBOXYLASE COMPLETE PROTEOME) protein domain (PD000180) which is seen in Q9KPT1_VIBCH.



Paralogs:  Local Blast Search

HD1238 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKILMLCREPRLYSCQRLKQACQDRNIQLDILDPNRMLIKLAVIDAQMQA
QLYYQAGEIYDKCRAEPSLLAEYDAVLPRFGVSSTMMGCRVLDYFAAKKV
VILNNSTAFRLARDKWSSLQVLAAQHIPIPTSSFAGALFSTAAHISQHRI
PLVIKTCSGSQGVGVMLSESKVHSVSLLQTLQQAKVDNLLQDFVVEARGQ
DIRAFVIGDRVVAAIERNGLENDFRANIHQGGSASVIQLNTAEQQLAVLA
AKTIGLDVAGVDLIRSNKGLLVLEVNACPGLDGIEKASKLDIAGLIIDYL
LAMKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGATACTTATGCTATGCCGTGAACCGCGGCTATATAGTTGCCAACG
TCTAAAACAGGCTTGTCAAGATCGTAATATTCAGTTAGATATTCTTGATC
CAAATAGAATGCTGATTAAATTAGCGGTAATTGATGCTCAAATGCAAGCA
CAACTTTATTATCAAGCGGGTGAAATTTATGATAAATGCCGTGCAGAGCC
TAGCTTGTTAGCAGAATATGATGCAGTATTACCTCGTTTTGGTGTTTCTA
GTACAATGATGGGGTGCCGCGTGTTAGATTATTTTGCGGCTAAAAAGGTT
GTTATTTTAAATAATTCAACCGCTTTTCGTTTAGCGCGTGATAAATGGTC
TAGTTTGCAAGTTCTAGCCGCACAACACATTCCCATTCCCACCAGTTCAT
TTGCCGGTGCGCTATTTAGTACTGCGGCGCATATATCTCAACATAGAATC
CCATTAGTGATTAAAACTTGTAGTGGATCACAAGGTGTCGGGGTGATGTT
GAGTGAGAGTAAAGTACATTCTGTCAGCTTATTGCAAACGCTACAGCAAG
CGAAAGTAGATAATTTATTACAGGATTTTGTTGTTGAAGCACGCGGGCAG
GATATTCGGGCTTTTGTGATTGGTGATCGCGTTGTGGCAGCGATCGAGCG
TAATGGGCTAGAAAATGATTTTAGAGCAAATATTCATCAAGGTGGATCCG
CAAGCGTTATTCAATTAAATACCGCTGAACAACAATTAGCGGTGCTTGCG
GCAAAAACAATAGGGCTTGATGTAGCTGGTGTTGATTTAATTCGCTCAAA
TAAAGGCTTATTAGTGCTAGAAGTGAATGCTTGTCCGGGATTAGATGGGA
TAGAAAAAGCCAGTAAACTAGACATTGCCGGCTTAATCATTGATTATCTG
TTAGCGATGAAAAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy