Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR901 IGR894 IGR899 IGR896 IGR895 IGR900 IGR897 IGR898 lctP, - HD1222 HD1223 HD1224 lpcA,gmhA,isn, - HD1228 ykgE, - HD1221 HD1220 HD1225 sapB, - HD1231 tyrR, - HD1229 sapA, - HD1230 HD1227 lctP, - HD1222 HD1223 HD1224 lpcA,gmhA,isn, - HD1228 ykgE, - HD1221 HD1220 HD1225 sapB, - HD1231 tyrR, - HD1229 sapA, - HD1230 HD1227 lpcA,gmhA,isn, - HD1228 ykgE, - HD1221 HD1220 HD1226 lctP, - HD1222 HD1224 HD1226 HD1223 HD1225 sapB, - HD1231 tyrR, - HD1229 sapA, - HD1230 HD1227 sapC, - HD1232 sapC, - HD1232
* Calculated from Protein Sequence

Gene ID: HD1228

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lpcA  gmhA  isn  

Definition:
phosphoheptose isomerase

Gene Start:
995426

Gene Stop:
994842

Gene Length:
585

Molecular Weight*:
21290

pI*:
6.00

Net Charge*:
-3.70

EC:
5.-.-.-  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  
Energy metabolism; Sugars  

Pathway: pathway table

Primary Evidence:
Bauer,B.A., Stevens,M.K. and Hansen,E.J.
Involvement of the Haemophilus ducreyi gmhA gene product in lipooligosaccharide expression and virulence.
Infect. Immun. 66(9): 4290-4298, 1998.
Medline: 98380377.

Secondary Evidence:
Preston,A., Maskell,D., Johnson,A. and Moxon,E.R.
Altered lipopolysaccharide characteristic of the I69 phenotype in Haemophilus influenzae results from mutations in a novel gene, isn.
J. Bacteriol. 178(2): 396-402, 1996.
Medline: 96134971.

Brooke,J.S. and Valvano,M.A.
Biosynthesis of inner core lipopolysaccharide in enteric bacteria identification and characterization of a conserved phosphoheptose isomerase.
J. Biol. Chem. 271(7): 3608-3614, 1996.
Medline: 96216460.

Brooke JS, Valvano MA.
Molecular cloning of the Haemophilus influenzae gmhA (lpcA) gene encoding a phosphoheptose isomerase required for lipooligosaccharide biosynthesis.
J Bacteriol. 1996 Jun;178(11):3339-41.
PMID: 8655517

Comment:
This enzyme is thought to be used in the first step of
glyceromannoheptose synthesis Brooke and Valvano, 1996).

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported gi 3560535 and 7387840 in GenBank.

Significant hits using gapped BLAST to phosphoheptose isomerase from H. influenzae (1176821, 972899), E. coli (1708000), Helicobacter pylori J99 (7387845), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. pneumoniae, or M. genitalium.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0279
COG name: Phosphoheptose isomerase
Functional Class:  G
The phylogenetic pattern of COG0279 is -m---q-cE-rHuj-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000281 (Helix-turn-helix domain, RpiR family) with a combined E-value of 7.6e-14.
    IPB000281B    98-145
***** IPB001347 (SIS domain) with a combined E-value of 9.7e-13.
    IPB001347A    54-62
    IPB001347B    113-138


ProDom Summary:  Protein Domain Search
Residues 30-187 are 32% similar to a (PROTEOME COMPLETE HI1657 PM0648) protein domain (PD033271) which is seen in Q9CN02_PASMU.

Residues 26-98 are identical to a (ISOMERASE PHOSPHOHEPTOSE 5.-.-.-) protein domain (PD033272) which is seen in LPCA_HAEDU.

Residues 100-150 are 58% similar to a (ISOMERASE PHOSPHOHEPTOSE 5.-.-.-) protein domain (PD308434) which is seen in LPCA_SYNY3.

Residues 30-163 are 49% similar to a (PROTEOME COMPLETE AMINOTRANSFERASE ISOMERASE) protein domain (PD000868) which is seen in LPCA_HELPJ.

Residues 34-182 are 33% similar to a (BIOSYNTHESIS ANTIBIOTIC LMBN LINCOMYCIN) protein domain (PD087206) which is seen in LMBN_STRLN.



Paralogs:  Local Blast Search
HD1228 is paralogously related to HD0801 (2e-17) and HD1380 (3e-04).


Pfam Summary:  Pfam Search
Residues 38 to 192 (E-value = 7.7e-44) place HD1228 in the SIS family which is described as SIS domain (PF01380)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MYLEQIKGELQEAADVLAKFMADEKNIQLIQEAALLIANSFKQGGKVLSC
GNGGSHCDAMHFAEELTGRYRENRPAYPAIAISDVSHLSCVSNDFGYEYV
FSRYIEAVGQTGDVLFGLSTSGNSKNVLNAINIAKEKGMKVIALTGKDGG
QMAGLADVEIRVPHFRYADRTQEIHIKVIHILMMLIEFEMAKTA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATTTAGAACAAATTAAAGGCGAACTTCAAGAAGCGGCGGACGTATT
AGCTAAATTTATGGCTGATGAAAAAAATATTCAATTAATTCAAGAAGCGG
CGCTATTAATTGCTAACAGTTTCAAACAAGGTGGTAAAGTACTCTCTTGT
GGCAATGGCGGTTCTCACTGTGATGCCATGCATTTCGCCGAAGAATTAAC
CGGGCGTTATCGCGAAAATCGCCCCGCTTATCCTGCTATTGCGATTTCTG
ATGTCAGCCATTTAAGCTGTGTAAGTAATGATTTTGGTTATGAATACGTC
TTTTCCCGCTACATAGAAGCGGTTGGTCAAACGGGTGATGTACTCTTTGG
TTTATCCACTTCTGGTAACTCAAAAAATGTATTAAATGCAATTAACATCG
CAAAAGAAAAAGGAATGAAAGTGATTGCTTTAACAGGCAAAGATGGCGGG
CAAATGGCAGGATTAGCAGATGTTGAAATTCGTGTTCCCCATTTTCGCTA
TGCCGATCGCACTCAAGAAATTCATATTAAAGTTATTCATATTTTAATGA
TGTTAATTGAGTTCGAAATGGCGAAAACCGCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy