Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Met-2 IGR894 IGR890 IGR893 IGR889 IGR896 IGR886 IGR895 IGR892 IGR891 IGR888 IGR887 IGR897 IGR898 lctP, - HD1222 HD1223 HD1224 HD1218 smpA, - HD1212 HD1211 HD1214 ykgE, - HD1221 HD1219 HD1220 HD1225 HD1215 HD1216 purF, - HD1209 HD1227 lctP, - HD1222 HD1223 HD1224 HD1218 smpA, - HD1212 HD1211 HD1214 ykgE, - HD1221 HD1219 HD1220 HD1225 HD1215 HD1216 purF, - HD1209 HD1227 HD1218 smpA, - HD1212 HD1211 HD1214 ykgE, - HD1221 HD1219 HD1220 HD1213 HD1226 lctP, - HD1222 HD1224 HD1213 HD1226 HD1223 HD1215 HD1216 purF, - HD1209 HD1227 purF, - HD1210 purF, - HD1210 HD1225
* Calculated from Protein Sequence

Gene ID: HD1218

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein (possible secreted protein)

Gene Start:
988295

Gene Stop:
987951

Gene Length:
345

Molecular Weight*:
12561

pI*:
4.70

Net Charge*:
-3.87

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 14-113 are 49% similar to 16760648 putative secreted protein [Salmonella enterica subsp. enterica serovar Typhi] and 49% similar to 16764601 putative periplasmic protein [Salmonella typhimurium LT2].

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1218 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKIQTALFSMIGLLATISAHATIMQQSSENEITKVVYACKDKNTLDVIFV
NTDKDSYAIINQVDEMIPMKNVKSASGAVYKPINPNYDYELATKGNTATL
LANDKPIIEECTLE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATACAAACCGCGCTATTCTCAATGATAGGCTTGTTAGCAACCAT
CTCTGCACACGCAACCATAATGCAACAAAGCTCAGAGAATGAAATCACCA
AAGTTGTATATGCTTGTAAAGATAAAAATACACTCGATGTTATTTTCGTG
AATACCGATAAAGATTCTTATGCGATCATCAATCAAGTAGATGAAATGAT
CCCAATGAAAAATGTAAAATCTGCCTCAGGTGCGGTGTATAAACCCATTA
ACCCGAATTACGACTATGAATTAGCCACAAAAGGAAACACAGCAACACTC
CTAGCCAACGATAAACCAATCATTGAAGAATGCACACTAGAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy