Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Met-2 IGR885 IGR890 IGR884 IGR893 IGR882 IGR889 IGR886 IGR892 IGR891 IGR888 IGR887 IGR883 HD1207 HD1218 smpA, - HD1212 HD1211 HD1214 HD1219 HD1220 HD1215 rnh,rnhA, - HD1206 cvpA,dedE, - HD1208 lapB, - HD1205 HD1216 purF, - HD1209 argG, - HD1204 HD1207 HD1218 smpA, - HD1212 HD1211 HD1214 HD1219 HD1220 HD1215 rnh,rnhA, - HD1206 cvpA,dedE, - HD1208 lapB, - HD1205 HD1216 purF, - HD1209 argG, - HD1204 HD1207 HD1218 smpA, - HD1212 HD1211 HD1214 HD1220 HD1213 HD1213 HD1219 rnh,rnhA, - HD1206 cvpA,dedE, - HD1208 lapB, - HD1205 HD1216 purF, - HD1209 argG, - HD1204 purF, - HD1210 purF, - HD1210 HD1215
* Calculated from Protein Sequence

Gene ID: HD1211

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
984804

Gene Stop:
984289

Gene Length:
516

Molecular Weight*:
19736

pI*:
4.60

Net Charge*:
-6.61

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
One weakly significant hit using gapped BLAST to OrfY from Actinobacillus actinomycetemcomitans (8096198): residues 51-157 are 28% similar to this protein.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 51-157 are 28% similar to a (PROTEOME PM1044 COMPLETE ORFY) protein domain (PD313759) which is seen in Q9JRS9_ACTAC.



Paralogs:  Local Blast Search
HD1211 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LVSYLILIEAIMFKVFSTIFINIISISTFAQMSPANSSEMTNQSPNIITS
EPKYKISATDTKILIRQLNNIEQCLFPELAGPNHQNIYNEWPVLENITMD
YFQSNILKELIGAENLETIEQDAASQAYFENLYEQYNHQIANVDKARCEN
FKPIYQEIKQRISTSIPQIYK$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGTTAGTTATTTAATTCTTATAGAAGCTATTATGTTCAAAGTTTTTTC
AACCATTTTTATTAATATAATAAGTATATCCACGTTTGCACAAATGTCGC
CCGCAAACTCATCAGAAATGACAAATCAATCGCCCAATATCATTACGTCT
GAACCCAAATATAAAATATCAGCAACTGATACCAAAATTCTTATCCGTCA
ATTAAATAATATAGAGCAATGCCTTTTCCCTGAACTTGCAGGACCAAACC
ACCAAAATATTTATAACGAATGGCCCGTACTTGAAAATATCACAATGGAC
TATTTTCAGTCAAACATTCTAAAAGAATTGATTGGTGCTGAAAATCTTGA
AACAATCGAACAAGATGCAGCATCACAAGCTTATTTTGAAAATTTATATG
AACAATATAATCATCAAATTGCTAATGTGGATAAAGCTCGTTGTGAGAAT
TTTAAACCGATCTACCAAGAAATAAAACAACGAATTTCAACGAGTATTCC
ACAAATTTATAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy