Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Met-2 IGR880 IGR885 IGR890 IGR884 IGR881 IGR882 IGR889 IGR886 IGR892 IGR891 IGR888 IGR887 IGR883 HD1207 HD1218 smpA, - HD1212 HD1211 HD1214 HD1219 waaQ, - HD1202 HD1203 HD1215 rnh,rnhA, - HD1206 cvpA,dedE, - HD1208 lapB, - HD1205 HD1216 purF, - HD1209 argG, - HD1204 HD1207 HD1218 smpA, - HD1212 HD1211 HD1214 HD1219 waaQ, - HD1202 HD1203 HD1215 rnh,rnhA, - HD1206 cvpA,dedE, - HD1208 lapB, - HD1205 HD1216 purF, - HD1209 argG, - HD1204 HD1207 smpA, - HD1212 HD1211 HD1214 HD1219 waaQ, - HD1202 HD1213 HD1213 HD1218 HD1203 HD1215 rnh,rnhA, - HD1206 cvpA,dedE, - HD1208 lapB, - HD1205 HD1216 purF, - HD1209 argG, - HD1204 purF, - HD1210 purF, - HD1210
* Calculated from Protein Sequence

Gene ID: HD1210

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
purF  

Definition:
glutamine amidophosphoribosyltransferase

Gene Start:
983656

Gene Stop:
984156

Gene Length:
501

Molecular Weight*:
18250

pI*:
6.00

Net Charge*:
-0.86

EC:
2.4.2.14  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Glutamate metabolism
Purine metabolism

Secondary Evidence:
Huffman JL, Lu F, Zalkin H, Brennan RG.
Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
Biochemistry. 2002 Jan 15;41(2):511-20.
PMID: 11781089

Muchmore,C.R., Krahn,J.M., Kim,J.H., Zalkin,H. and Smith,J.L.
Crystal structure of glutamine phosphoribosylpyrophosphate
amidotransferase from Escherichia coli.
Protein Sci. 7(1): 39-51, 1998
Medline: 98173193.

Tso,J.Y., Zalkin,H., van Cleemput,M., Yanofsky,C. and Smith,J.M.
Nucleotide sequence of Escherichia coli purF and deduced amino acid sequence of glutamine phosphoribsosylpyrophosphate amidotransferase.
J. Biol. Chem. 257:3525-3531, 1982.
Medline: 82142516.

Sampei,G. and Mizobuchi,K.
Nucleotide sequence of the Escherichia coli purF gene encoding
amidophosphoribosyltransferase for de novo purine nucleotide
synthesis.
Nucleic Acids Res. 16(17): 8717, 1988.
Medline: 88335626.


Tso,J.Y., Hermodson,M.A. and Zalkin,H.
Glutamine phosphoribosylpyrophosphate amidotransferase from cloned
Escherichia coli purF. NH2-terminal amino acid sequence,
identification of the glutamine site, and trace metal analysis.
J. Biol. Chem. 257(7): 3532-3536, 1982.
Medline: 82142517.

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to amidophosphoribosyltransferase from H. influenzae (1172750), Pasteurella multocida (7716501), E. coli (42591), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0034
COG name: Glutamine phosphoribosylpyrophosphate amidotransferase
Functional Class:  F
The phylogenetic pattern of COG0034 is amtkyqvcebrh---------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002375 (Purine/pyrimidine phosphoribosyl transferase) with a combined E-value of 6.1e-07.
    IPB002375B    24-39


ProDom Summary:  Protein Domain Search
Residues 1-131 are 78% similar to a (AMIDOTRANSFERASE GLUTAMINE) protein domain (PD002836) which is seen in PUR1_HAEIN.



Paralogs:  Local Blast Search
HD1210 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1ECF|B Chain B, Escherichia Coli Glutamine Phosphoribosylpy... 210 8e-056
pdb|1AO0|A Chain A, Glutamine Phosphoribosylpyrophosphate (Prpp... 108 6e-025
pdb|1GPH|1 Chain 1, Glutamine Phosphoribosylpyrophosphate (Prpp... 106 1e-024

Gene Protein Sequence:
MPGQAQRKSSVRRKLNAIPTEFKGKNVLLVDDSIVRGTTSEQIVEMARAA
GAKKVYFASAAPEIRYPNVYGIDMPTCEELVAYNRSVEDVAKMIGVDKLI
FQDLDALYKAIQTENPNIDGFDASVFTGKYITGDVDKNYLDAIACARSDK
AKVAKQATNLEIHNES$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGGGACAAGCACAACGAAAAAGCTCTGTTCGCCGTAAATTAAATGC
TATTCCAACGGAGTTTAAAGGCAAAAATGTATTGCTAGTCGATGATTCAA
TTGTTCGGGGAACTACGTCAGAACAAATTGTAGAGATGGCACGCGCAGCA
GGTGCTAAAAAAGTTTACTTTGCTTCAGCCGCACCAGAAATTCGTTATCC
TAATGTATATGGTATTGATATGCCAACTTGCGAAGAATTAGTCGCGTATA
ACCGCTCTGTGGAAGACGTAGCTAAAATGATCGGTGTGGATAAATTAATT
TTCCAAGATCTTGATGCACTGTATAAAGCTATTCAAACAGAAAATCCTAA
TATTGATGGTTTTGATGCTTCGGTATTTACGGGCAAATATATCACCGGTG
ATGTAGATAAAAATTACCTTGATGCAATTGCTTGTGCCCGTAGTGATAAA
GCCAAAGTCGCGAAACAAGCAACCAATTTAGAAATTCATAACGAAAGCTA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy