Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Met-2 IGR880 IGR885 IGR890 IGR884 IGR881 IGR882 IGR889 IGR886 IGR891 IGR888 IGR883 IGR887 HD1207 HD1218 smpA, - HD1212 HD1211 HD1214 waaQ, - HD1202 HD1203 HD1215 rnh,rnhA, - HD1206 cvpA,dedE, - HD1208 lapB, - HD1205 HD1216 purF, - HD1209 argG, - HD1204 HD1207 HD1218 smpA, - HD1212 HD1211 HD1214 waaQ, - HD1202 HD1203 HD1215 rnh,rnhA, - HD1206 cvpA,dedE, - HD1208 lapB, - HD1205 HD1216 purF, - HD1209 argG, - HD1204 HD1207 HD1218 smpA, - HD1212 HD1211 HD1214 waaQ, - HD1202 HD1213 HD1213 HD1203 rnh,rnhA, - HD1206 cvpA,dedE, - HD1208 lapB, - HD1205 HD1216 purF, - HD1209 argG, - HD1204 purF, - HD1210 purF, - HD1210 HD1215
* Calculated from Protein Sequence

Gene ID: HD1209

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
purF  

Definition:
amidophosphoribosyltransferase (glutamine phosphoribosylpyrophosphate amidotransferase)

Gene Start:
982644

Gene Stop:
983696

Gene Length:
1053

Molecular Weight*:
38946

pI*:
6.30

Net Charge*:
-3.96

EC:
2.4.2.14  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Glutamate metabolism
Purine metabolism

Secondary Evidence:
Muchmore,C.R., Krahn,J.M., Kim,J.H., Zalkin,H. and Smith,J.L. Crystal structure of glutamine phosphoribosylpyrophosphate
amidotransferase from Escherichia coli.
Protein Sci. 7(1):39-51,1998.
Medline: 98173193.

Tso,J.Y., Zalkin,H., van Cleemput,M., Yanofsky,C. and Smith,J.M. Nucleotide sequence of Escherichia coli purF and deduced amino acid sequence of glutamine phosphoribsosylpyrophosphate amidotransferase.
J. Biol. Chem. 257: 3525-3531,1982.
Medline: 82142516.

Sampei,G. and Mizobuchi,K.
Nucleotide sequence of the Escherichia coli purF gene encoding amidophosphoribosyltransferase for de novo purine nucleotide synthesis.
Nucleic Acids Res. 16(17): 8717,1988.
Medline: 88335626.

Tso,J.Y., Hermodson,M.A. and Zalkin,H.
Glutamine phosphoribosylpyrophosphate amidotransferase from cloned Escherichia coli purF. NH2-terminal amino acid sequence, identification of the glutamine site, and trace metal analysis.
J. Biol. Chem. 257(7): 3532-3536,1982.
Medline: 82142517.

Comment:


Blast Summary:  PSI-Blast Search
Many strong significant hits using gapped BLAST to from Pasteurella multocida (7716501), H. influenzae (1172750), E. coli (42593, 2507261), among others.

HD1209 is similar to glucosamine-fructose-6-phosphate aminotransferase from C. trachomatis (CT816), T. pallidum (TP0861), and C. pneumoniae (CPn0968). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0034
COG name: Glutamine phosphoribosylpyrophosphate amidotransferase
Functional Class: F
The phylogenetic pattern of COG0034 is amtkyqvcebrh---------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000583 (Glutamine amidotransferase class-II) with a combined E-value of 7.7e-16.
    IPB000583A    24-34
    IPB000583B    70-79
    IPB000583C    101-129


ProDom Summary:  Protein Domain Search
Residues 64-236 are 75% similar to a (AMIDOTRANSFERASE ASPARAGINE AMINOTRANSFERASE GLUTAMINE) protein domain (PD000635) which is seen in PUR1_HAEIN.

Residues 252-331 are 82% similar to a (AMIDOTRANSFERASE GLUTAMINE) protein domain (PD002836) which is seen in PUR1_PASMU.

Residues 2-54 are 84% similar to a (AMIDOTRANSFERASE AMINOTRANSFERASE GLUTAMINE) protein domain (PD001242) which is seen in PUR1_PASMU.



Paralogs:  Local Blast Search
HD1209 is paralogously related to HD1894 (1e-15).


Pfam Summary:  Pfam Search
Residues 2 to 138 (E-value = 1.8e-69) place HD1209 in the GATase_2 family which is described as Glutamine amidotransferases class-II (PF00310)

PDB Hit:
pdb|1ECF|B Chain B, Escherichia Coli Glutamine Phosphoribosylpy... 483 1e-137
pdb|1AO0|A Chain A, Glutamine Phosphoribosylpyrophosphate (Prpp... 194 1e-050
pdb|1GPH|1 Chain 1, Glutamine Phosphoribosylpyrophosphate (Prpp... 194 1e-050

Gene Protein Sequence:
MCGIVGIIGKSPVNQAIYDGLTLLQHRGQDAAGIVTIDEENCFRLRKANG
LVSDVFHQEHMLRLQGNAGIGHVRYPTAGSSSVSEAQPFYVNSPFGLTLV
HNGNLTNNSELKERLYNEARRHVNTNSDSESLLNIFAHYLDQNTTAYLTA
ENIFETVRKTNEVIRGAYACIAMIVGHGMVAFRDPFGIRPLVLGKRIVAD
QTEYMFASESVALDIVGFEFVRDVQPGEAIYVTFDGELYSAICADKPKLN
PCIFEYVYFARPDSVIDGVSVYSARVHMGELLGEKIKNEWGRLVDEIDVV
IPIPETSNDIAVRIANVLYKPYRQGFVKNRYCCPHLYYAGTSTTKKLCSP
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGCGGCATTGTCGGCATTATTGGAAAATCGCCAGTCAATCAGGCGAT
TTATGATGGATTAACATTGCTTCAACATCGTGGTCAAGATGCGGCAGGTA
TTGTGACCATTGATGAAGAAAATTGTTTCCGCTTACGCAAAGCAAATGGC
TTAGTAAGCGATGTATTTCATCAAGAACATATGCTGCGTTTGCAAGGAAA
TGCGGGTATTGGTCACGTACGTTATCCAACGGCTGGATCATCAAGTGTAT
CAGAAGCTCAGCCTTTCTATGTGAATTCACCTTTTGGTTTAACCTTAGTG
CATAATGGCAACTTAACGAATAATAGTGAATTAAAAGAACGTCTTTATAA
TGAAGCTCGGCGCCACGTGAATACCAATTCAGATTCTGAGTCTTTATTAA
ATATTTTTGCACATTATCTTGATCAAAATACCACCGCTTATTTAACGGCT
GAAAATATTTTTGAAACAGTTCGTAAAACAAATGAAGTGATTCGTGGCGC
TTATGCCTGTATTGCTATGATTGTAGGGCACGGTATGGTCGCTTTCCGTG
ACCCATTTGGAATTCGACCGCTTGTTTTAGGTAAACGCATTGTAGCGGAC
CAAACTGAATATATGTTTGCTTCTGAAAGCGTTGCACTTGATATTGTTGG
TTTTGAATTTGTACGAGATGTGCAGCCAGGAGAGGCAATTTATGTTACCT
TTGATGGTGAATTATATTCCGCTATTTGTGCCGATAAGCCTAAATTAAAC
CCTTGTATTTTTGAATATGTTTATTTTGCGCGCCCAGATTCTGTGATCGA
TGGTGTTTCAGTCTATAGCGCACGAGTACATATGGGAGAATTACTTGGCG
AAAAAATTAAAAATGAGTGGGGAAGATTGGTTGATGAAATTGATGTTGTT
ATCCCTATTCCTGAAACATCTAATGATATTGCAGTCCGCATTGCTAATGT
TCTTTACAAGCCATATCGTCAAGGATTTGTTAAAAATCGTTATTGTTGCC
CGCACCTTTATTATGCCGGGACAAGCACAACGAAAAAGCTCTGTTCGCCG
TAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy