Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR880 IGR885 IGR884 IGR879 IGR876 IGR881 IGR882 IGR877 IGR878 IGR886 IGR875 IGR883 IGR887 HD1207 HD1200 HD1211 gloB, - HD1197 pgpB, - HD1199 uppS, - HD1196 waaQ, - HD1202 HD1203 rnh,rnhA, - HD1206 cvpA,dedE, - HD1208 lapB, - HD1205 lgtF, - HD1201 purF, - HD1209 argG, - HD1204 HD1207 HD1200 HD1211 gloB, - HD1197 pgpB, - HD1199 uppS, - HD1196 waaQ, - HD1202 HD1203 rnh,rnhA, - HD1206 cvpA,dedE, - HD1208 lapB, - HD1205 lgtF, - HD1201 purF, - HD1209 argG, - HD1204 HD1207 HD1200 HD1211 gloB, - HD1197 pgpB, - HD1199 uppS, - HD1196 waaQ, - HD1202 HD1203 rnh,rnhA, - HD1206 cvpA,dedE, - HD1208 lapB, - HD1205 lgtF, - HD1201 purF, - HD1209 argG, - HD1204 purF, - HD1210 purF, - HD1210
* Calculated from Protein Sequence

Gene ID: HD1204

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
argG  

Definition:
argininosuccinate synthetase

Gene Start:
979179

Gene Stop:
980510

Gene Length:
1332

Molecular Weight*:
49271

pI*:
5.10

Net Charge*:
-9.61

EC:
6.3.4.5  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Alanine and aspartate metabolism
Arginine and proline metabolism
Urea cycle and metabolism of amino groups

Secondary Evidence:
Van Vliet,F., Crabeel,M., Boyen,A., Tricot,C., Stalon,V., Falmagne,P., Nakamura,Y., Baumberg,S. and Glansdorff,N.
Sequences of the genes encoding argininosuccinate synthetase in Escherichia coli and Saccharomyces cerevisiae: comparison with methanogenic archaebacteria and mammals.
Gene 95(1): 99-104,1990.
Medline: 91071613.

Lemke,C., Yeung,M. and Howell,P.L.
Expression, purification, crystallization and preliminary X-ray analysis of Escherichia coli argininosuccinate synthetase.
Acta Crystallogr. D 55: 2028-2030, 1999.

Comment:
For other "arg" genes, see HD1033 (argH), HD0892 (argD), HD1384 (argA), HD0262 (argR), HD0890 (argC), HD0891 (argB).

Blast Summary:  PSI-Blast Search
Numerous strong significant hits using gapped BLAST to argininosuccinate synthase from H. influenzae (1168540), Neisseria meningitidis (7379060, 7227385), E. coli (1168538), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0137
COG name: Argininosuccinate synthase
Functional Class:  E
The phylogenetic pattern of COG0137 is amt-yqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001518 (Argininosuccinate synthase) with a combined E-value of 1.6e-109.
    IPB001518A    17-28
    IPB001518B    36-48
    IPB001518C    52-94
    IPB001518D    104-142
    IPB001518E    190-206
    IPB001518F    235-248
    IPB001518G    266-309
    IPB001518H    331-340
    IPB001518I    357-368


ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search

HD1204 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 16 to 420 (E-value = 1.2e-181) place HD1204 in the Arginosuc_synth family which is described as Arginosuccinate synthase (PF00764)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSATILESLPLGQKVGIAFSGGLDTSAALLWMRKKGAIPYAYTANLGQPD
ENDYNAIPNKAMEYGAENARLIDCRTQLAHEGIAAIQCGAFHISTGGIPY
FNTTPLGRAVTGTMLVAAMKEDNVNIWGDGSTFKGNDIERFYRYGLLTNP
KLKIYKPWLDQLFIDELGGRFEMSQFLISNGFDYKMSVEKAYSTDSNMLG
ATHEAKDLEELGTDMKIVKPIMGVAFWDESVEIKPEIVSVTFEEGIPVAL
NGKRIDDAVELILEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMAI
LHIAYERLVTGIHNEDTIEQYRINGLRLGRLLYQGRWFDPQALMLRETAQ
RWVAKAIAGTVTLELRRGNDFSILNTESVNLTYQAERLSMEKVEDAPFTP
ADRIGQLTMRNLDIVDTRDKLAVYTDAGLLSVQNNVIPQLNKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAGCAACGATTTTAGAATCTCTCCCATTAGGTCAAAAGGTTGGTAT
CGCTTTCTCAGGTGGTTTGGATACTTCAGCCGCGTTACTTTGGATGCGTA
AAAAAGGTGCAATACCTTATGCATATACTGCCAATTTAGGCCAACCAGAT
GAAAATGATTACAATGCAATTCCAAACAAAGCGATGGAATATGGTGCAGA
AAATGCCCGCTTAATTGATTGCCGTACTCAATTAGCTCACGAAGGGATTG
CCGCAATTCAATGTGGAGCATTTCATATTTCAACAGGTGGTATTCCATAT
TTCAATACTACACCGCTTGGCCGAGCAGTAACAGGCACAATGCTTGTGGC
AGCAATGAAAGAAGATAATGTGAATATTTGGGGGGATGGTTCAACGTTTA
AAGGTAATGATATTGAACGTTTTTACCGCTATGGCTTATTAACTAATCCA
AAATTAAAAATTTATAAACCTTGGTTAGATCAGCTTTTTATTGATGAGCT
TGGCGGTCGTTTTGAAATGTCACAATTTTTAATTTCAAACGGCTTTGATT
ATAAAATGTCTGTTGAAAAAGCATATTCGACTGATTCAAATATGTTAGGC
GCTACCCACGAAGCAAAAGATTTAGAAGAACTTGGCACGGATATGAAAAT
TGTCAAGCCAATTATGGGCGTTGCATTTTGGGATGAATCGGTTGAAATTA
AACCAGAAATTGTATCGGTCACCTTTGAAGAAGGGATTCCTGTTGCTTTA
AATGGTAAACGGATTGATGATGCAGTTGAATTAATCTTAGAAGCAAACCG
TATCGGTGGCCGTCATGGCTTAGGTATGTCAGATCAAATTGAAAACCGTA
TTATTGAAGCAAAATCACGTGGAATTTATGAAGCGCCAGGAATGGCAATA
TTACATATTGCTTATGAGCGTTTAGTGACGGGTATTCATAATGAAGACAC
GATAGAACAATATCGTATCAATGGCTTGCGTTTAGGGCGTTTATTATATC
AAGGTCGTTGGTTTGATCCTCAAGCGTTAATGTTACGAGAAACGGCACAA
CGTTGGGTCGCAAAAGCAATTGCGGGCACGGTAACATTAGAATTACGGCG
TGGTAATGATTTCAGCATTTTAAATACTGAATCGGTTAATTTAACTTATC
AAGCAGAGCGGTTAAGTATGGAAAAAGTCGAAGATGCACCTTTTACCCCT
GCTGATCGTATAGGTCAATTAACTATGCGTAATTTAGACATTGTTGATAC
ACGTGATAAACTAGCTGTTTATACGGACGCAGGTTTATTATCTGTGCAAA
ATAATGTTATTCCACAATTGAATAAAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy