Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR880 IGR873 IGR874 IGR884 IGR879 IGR876 IGR881 IGR882 IGR877 IGR878 IGR875 IGR883 HD1207 HD1200 gloB, - HD1197 uppS, - HD1196 pgpB, - HD1199 cdsA, - HD1193 waaQ, - HD1202 ecfE,yaeL, - HD1192 HD1203 rnh,rnhA, - HD1206 cvpA,dedE, - HD1208 lapB, - HD1205 lgtF, - HD1201 argG, - HD1204 HD1207 HD1200 gloB, - HD1197 uppS, - HD1196 pgpB, - HD1199 cdsA, - HD1193 waaQ, - HD1202 ecfE,yaeL, - HD1192 HD1203 rnh,rnhA, - HD1206 cvpA,dedE, - HD1208 lapB, - HD1205 lgtF, - HD1201 argG, - HD1204 HD1207 HD1200 gloB, - HD1197 uppS, - HD1196 pgpB, - HD1199 cdsA, - HD1193 waaQ, - HD1202 ecfE,yaeL, - HD1192 HD1203 rnh,rnhA, - HD1206 cvpA,dedE, - HD1208 lapB, - HD1205 lgtF, - HD1201 argG, - HD1204
* Calculated from Protein Sequence

Gene ID: HD1201

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lgtF  

Definition:
beta 1-4 glucosyltransferase

Gene Start:
977138

Gene Stop:
977896

Gene Length:
759

Molecular Weight*:
28721

pI*:
8.60

Net Charge*:
3.83

EC:
2.-.-.-  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table

Primary Evidence:
Filiatrault,M.J., Gibson,B.W., Schilling,B., Sun,S., Munson,R.S.
Jr. and Campagnari,A.A.
Construction and Characterization of Haemophilus ducreyi
Lipooligosaccharide (LOS) Mutants Defective in Expression of
Heptosyltransferase III and beta 1,4-Glucosyltransferase:
Identification of LOS Glycoforms Containing Lactosamine Repeats
JOURNAL Infect. Immun. 68 (6), 3352-3361 (2000)
MEDLINE: 20278119


Secondary Evidence:
Guasch,J.F., Pique,N., Climent,N., Ferrer,S., Merino,S., Rubires,X., Tomas,J.M. and Regue,M.
Cloning and characterization of two Serratia marcescens genes involved in core lipopolysaccharide biosynthesis.
J. Bacteriol. 178(19): 5741-5747, 1996.
Medline: 96422003.

Comment:
0

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported gi 8118046 in GenBank.

Several significant hits using gapped BLAST to putative glycosyl transferases from H. influenzae (1175279), and to lipopolysaccharide (LPS) core biosynthesis glycosyl transferases from Serratia marcescens (8471672), Klebsiella pneumoniae (8479589), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0463
COG name: Glycosyltransferases involved in cell wall biogenesis
Functional Class:  M
The phylogenetic pattern of COG0463 is AMTKYQVCEBRHujGPo---X
Number of proteins in this genome belonging to this COG is 5

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 3-53 are identical to a (TRANSFERASE COMPLETE PROTEOME GLYCOSYLTRANSFERASE) protein domain (PD000196) which is seen in Q9L875_HAEDU.

Residues 65-243 are identical to a (TRANSFERASE GLYCOSYLTRANSFERASE PROTEOME) protein domain (PD011199) which is seen in Q9L875_HAEDU.

Residues 2-63 are 61% similar to a (PROTEOME GLYCOSYLTRANSFERASE COMPLETE) protein domain (PD247292) which is seen in Q9KVC2_VIBCH.



Paralogs:  Local Blast Search
HD1201 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 193 (E-value = 6.2e-19) place HD1201 in the Glycos_transf_2 family which is described as Glycosyl transferase (PF00535)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MPTLTVAMIVKNEAQDLAECLKTVDGWVDEIVIVDSGSTDDTLKIATQFN
AKVYVNSDWQGFGPQRQFAQQYVTSDYVLWLDADERVTPELKASILQAVQ
HNQKNTVYKVSRLSEIFGKEIRYSGWYPDYVVRLYPTYLAKYGDELVHEK
VHYPADSRVEKLQGDLLHFTYKNIHHYLVKSASYAKAWAMQRAKAGKKAS
LLDGVTHAIACFLKMYLFKAGFLDGKQGFLLAVLSAHSTFVKYADLWDRT
RS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCAACATTAACGGTTGCAATGATTGTAAAAAACGAAGCACAAGATCT
TGCAGAATGTCTTAAAACGGTTGACGGCTGGGTTGATGAAATAGTGATTG
TCGATAGTGGTAGTACTGATGATACATTAAAAATTGCCACGCAATTTAAT
GCAAAAGTATATGTTAATAGTGATTGGCAAGGTTTTGGTCCACAGAGACA
ATTTGCTCAGCAGTATGTAACGAGTGATTATGTTTTATGGCTTGATGCGG
ATGAACGTGTTACACCTGAATTAAAAGCCAGTATCTTACAAGCGGTTCAA
CATAATCAGAAAAATACAGTGTATAAAGTCAGTCGCTTAAGTGAAATTTT
TGGCAAAGAAATTCGCTATTCAGGTTGGTATCCTGATTATGTAGTAAGGT
TATATCCTACCTATTTAGCTAAATATGGCGATGAATTAGTACACGAGAAA
GTGCATTATCCTGCGGATAGCAGGGTGGAAAAATTACAGGGCGATTTATT
GCATTTTACCTACAAAAATATTCATCACTATTTAGTGAAATCGGCTAGCT
ATGCAAAAGCGTGGGCAATGCAACGGGCTAAAGCGGGTAAAAAAGCAAGT
TTGTTAGATGGAGTAACACATGCAATTGCTTGTTTTTTGAAAATGTATCT
GTTTAAAGCAGGTTTCTTAGATGGTAAGCAAGGCTTTTTACTTGCCGTTT
TGTCAGCCCATTCTACCTTTGTAAAATACGCTGACTTATGGGATCGTACA
CGGAGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy