Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR880 IGR873 IGR874 IGR879 IGR872 IGR876 IGR881 IGR882 IGR877 IGR878 IGR875 IGR883 HD1200 gloB, - HD1197 pgpB, - HD1199 uppS, - HD1196 cdsA, - HD1193 waaQ, - HD1202 ecfE,yaeL, - HD1192 D15, - HD1191 HD1203 lapB, - HD1205 lgtF, - HD1201 argG, - HD1204 HD1200 gloB, - HD1197 pgpB, - HD1199 uppS, - HD1196 cdsA, - HD1193 waaQ, - HD1202 ecfE,yaeL, - HD1192 D15, - HD1191 HD1203 lapB, - HD1205 lgtF, - HD1201 argG, - HD1204 HD1200 gloB, - HD1197 pgpB, - HD1199 uppS, - HD1196 cdsA, - HD1193 waaQ, - HD1202 ecfE,yaeL, - HD1192 D15, - HD1191 HD1203 lapB, - HD1205 lgtF, - HD1201 argG, - HD1204
* Calculated from Protein Sequence

Gene ID: HD1199

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pgpB  

Definition:
phosphatidylglycerophosphatase B

Gene Start:
976640

Gene Stop:
975912

Gene Length:
729

Molecular Weight*:
28616

pI*:
10.60

Net Charge*:
11.81

EC:
3.1.3.27  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Primary Evidence:
Filiatrault,M.J., Gibson,B.W., Schilling,B., Sun,S., Munson,R.S. Jr. and Campagnari,A.A.
Construction and Characterization of Haemophilus ducreyi Lipooligosaccharide (LOS) Mutants Defective in Expression of Heptosyltransferase III and beta 1,4-Glucosyltransferase: Identification of LOS Glycoforms Containing Lactosamine Repeats. Infect. Immun. 68(6): 3352-3361, 2000.
MEDLINE: 20278119


Secondary Evidence:
Icho,T.
Membrane-bound phosphatases in Escherichia coli: sequence of the pgpB gene and dual subcellular localization of the pgpB product. J. Bacteriol. 170(11): 5117-5124, 1998.
Medline: 89033893.

Dillon DA, Wu WI, Riedel B, Wissing JB, Dowhan W, Carman GM.
The Escherichia coli pgpB gene encodes for a diacylglycerol pyrophosphate phosphatase activity.
J Biol Chem. 1996 Nov 29;271(48):30548-53.
PMID: 8940025

Comment:
0

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously sequenced 8118048 in GenBank.

Significant hits using gapped BLAST to phosphatidylglycerophosphatase B from H. influenzae (1172464), E. coli (129945), and to orf16 from Actinobacillus actinomycetemcomitans (7592821).

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
BeTs to 7 clades of COG0671
COG name: Predicted phosphatases
Functional Class:  R
The phylogenetic pattern of COG0671 is -mtkYq-cEBrhUJ---l--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 176-229 are identical to a (B PROTEOME PHOSPHATIDYLGLYCEROPHOSPHATASE) protein domain (PD412037) which is seen in Q9L873_HAEDU.

Residues 4-135 are identical to a (MEMBRANE PHOSPHATIDYLGLYCEROPHOSPHATASE) protein domain (PD034804) which is seen in Q9L873_HAEDU.



Paralogs:  Local Blast Search
HD1199 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 60 to 234 (E-value = 1.1e-16) place HD1199 in the PAP2 family which is described as PAP2 superfamily (PF01569)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MITVIKRLSFYTFLMLLIPFITWAINWRWIDDQILHADVDHFLYWLTETG
SVPYAAITCVILTLWLIALTRRHYSWILIGTLCVISMFGTQLIKTAAKNV
FAEPRPYVQQMMGDKVQAFYQLERSERAMIVQQYYQQSKYPLIIKHRMHE
TGYSFPSGHTIFSVSWLLLFSGLLFGIKNRFASVSQIFIVVWSALMLISR
LRLGMHFPIDLLASTLIAWLFHLMLFIWLLPYFKKWRLFTNN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCACTGTGATAAAACGACTTTCTTTTTATACCTTTTTGATGTTATT
AATTCCATTCATTACTTGGGCGATTAATTGGCGTTGGATTGATGATCAAA
TTTTACATGCTGATGTTGATCATTTTTTATATTGGTTAACTGAAACGGGT
TCTGTGCCTTATGCAGCAATAACCTGTGTAATATTAACGTTATGGTTAAT
AGCGTTAACTCGTCGGCATTATTCTTGGATTTTAATTGGCACGCTGTGTG
TAATTTCCATGTTTGGCACCCAATTAATCAAAACTGCCGCTAAAAATGTA
TTTGCAGAACCTCGTCCTTACGTTCAGCAAATGATGGGAGATAAAGTACA
AGCGTTTTATCAGTTAGAGCGGTCTGAACGTGCTATGATTGTGCAACAAT
ACTATCAACAAAGTAAATACCCGCTAATTATCAAGCACCGCATGCATGAA
ACCGGCTATTCATTTCCTTCTGGACACACTATTTTTTCTGTTTCTTGGCT
ATTATTATTTAGCGGTTTATTATTCGGCATAAAAAACCGATTCGCGAGCG
TCAGCCAAATATTCATTGTAGTATGGTCAGCATTAATGCTAATTAGCCGA
TTACGCTTAGGGATGCATTTTCCTATTGATTTATTGGCCAGTACGTTAAT
TGCTTGGTTATTCCACCTTATGCTATTTATATGGCTATTACCTTATTTTA
AAAAGTGGCGATTATTCACCAATAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy