Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR880 IGR873 IGR874 IGR879 IGR872 IGR876 IGR881 IGR877 IGR878 IGR875 HD1200 gloB, - HD1197 pgpB, - HD1199 uppS, - HD1196 cdsA, - HD1193 waaQ, - HD1202 ecfE,yaeL, - HD1192 D15, - HD1191 HD1203 lgtF, - HD1201 argG, - HD1204 HD1200 gloB, - HD1197 pgpB, - HD1199 uppS, - HD1196 cdsA, - HD1193 waaQ, - HD1202 ecfE,yaeL, - HD1192 D15, - HD1191 HD1203 lgtF, - HD1201 argG, - HD1204 HD1200 gloB, - HD1197 pgpB, - HD1199 uppS, - HD1196 cdsA, - HD1193 waaQ, - HD1202 ecfE,yaeL, - HD1192 D15, - HD1191 HD1203 lgtF, - HD1201 argG, - HD1204
* Calculated from Protein Sequence

Gene ID: HD1197

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
gloB  

Definition:
hydroxyacylglutathione hydrolase (glyoxylase II) (GloB)

Gene Start:
975862

Gene Stop:
975155

Gene Length:
708

Molecular Weight*:
26388

pI*:
6.30

Net Charge*:
-4.46

EC:
3.1.2.6  

Functional Class:
Unassigned  

Pathway: pathway table
Pyruvate metabolism

Comment:


Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to probable hydroxyacylglutathione hydrolase from H. influenzae (2494854), Neisseria meningitidis (7227260), E. coli (2494853), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
BeTs to 9 clades of COG0491
COG name: Zn-dependent hydrolases, including glyoxylases
Functional Class: R
The phylogenetic pattern of COG0491 is AMtKYQVCEBRHuj-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001587 (Uncharacterized protein family UPF0036) with a combined E-value of 3.4e-07.
    IPB001587B    29-77


ProDom Summary:  Protein Domain Search
Residues 134-220 are 50% similar to a (HYDROLASE II HYDROXYACYLGLUTATHIONE) protein domain (PD006722) which is seen in Q9JWC6_NEIMA.

Residues 2-76 are 47% similar to a (HYDROLASE II HYDROXYACYLGLUTATHIONE) protein domain (PD336625) which is seen in Q9KPX6_VIBCH.

Residues 134-233 are 50% similar to a (HYDROLASE II HYDROXYACYLGLUTATHIONE) protein domain (PD082387) which is seen in Q9CMW8_PASMU.



Paralogs:  Local Blast Search
HD1197 is paralogously related to HD1020 (2e-07).


Pfam Summary:  Pfam Search
Residues 12 to 165 (E-value = 2e-26) place HD1197 in the Lactamase_B family which is described as Metallo-beta-lactamase superfamily (PF00753)

PDB Hit:
pdb|1QH5|A Chain A, Human Glyoxalase Ii With S-(N-Hydroxy-N- Br... 136 3e-033

Gene Protein Sequence:
MLKITAIPALQDNYIWAIQQGQEVMIVDPAQADPVFHFLAKNKLNLTTIL
ITHYHQDHIGGIAGLQATYPDLTIYGSHEVAQYVNHIVQAGDHLHLLNSD
VEVINSAGHTAQHISFLFAQQYLFCGDALFSAGCGRVFTGDYQAQFNTLQ
RFKTLPESTLVFPAHEYTLTNLKFAASVLPNNNDIREAQARAETLRAQQQ
PTLPSTIKQELRINPFLQADNLAEFITLRQQKDQY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAAAGATTACCGCTATTCCTGCCTTACAAGATAATTACATTTGGGC
TATTCAACAAGGTCAGGAAGTGATGATTGTTGATCCTGCCCAAGCCGATC
CCGTTTTTCACTTTTTGGCAAAAAATAAACTTAATCTGACCACTATTCTT
ATCACACATTATCACCAAGATCATATTGGTGGCATTGCTGGATTACAAGC
CACATACCCTGACTTAACGATTTATGGTTCACATGAAGTGGCACAATACG
TTAATCATATTGTGCAAGCGGGTGATCATTTACACTTATTGAATTCTGAT
GTTGAAGTGATAAACAGTGCTGGCCATACTGCGCAACATATAAGCTTTCT
ATTTGCACAACAATATCTTTTTTGTGGCGATGCCCTTTTTTCTGCTGGTT
GTGGCCGTGTATTTACTGGCGATTATCAAGCTCAATTTAACACATTACAA
CGCTTTAAGACTTTACCGGAAAGCACCTTAGTTTTTCCCGCGCATGAATA
TACTTTAACTAATTTAAAATTTGCTGCCAGCGTCTTGCCCAATAATAATG
ATATACGGGAAGCTCAAGCACGAGCAGAAACTTTACGTGCACAGCAACAA
CCAACACTTCCTTCCACCATAAAACAGGAACTACGTATTAATCCTTTCTT
ACAAGCGGATAATTTAGCCGAGTTTATTACGCTACGCCAACAAAAAGATC
AATATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy