Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR880 IGR873 IGR874 IGR879 IGR872 IGR876 IGR881 IGR877 IGR878 IGR875 HD1200 gloB, - HD1197 pgpB, - HD1199 uppS, - HD1196 cdsA, - HD1193 waaQ, - HD1202 ecfE,yaeL, - HD1192 D15, - HD1191 HD1203 lgtF, - HD1201 argG, - HD1204 HD1200 gloB, - HD1197 pgpB, - HD1199 uppS, - HD1196 cdsA, - HD1193 waaQ, - HD1202 ecfE,yaeL, - HD1192 D15, - HD1191 HD1203 lgtF, - HD1201 argG, - HD1204 HD1200 gloB, - HD1197 pgpB, - HD1199 uppS, - HD1196 cdsA, - HD1193 waaQ, - HD1202 ecfE,yaeL, - HD1192 D15, - HD1191 lgtF, - HD1201 argG, - HD1204 HD1203
* Calculated from Protein Sequence

Gene ID: HD1196

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
uppS  

Definition:
undecaprenyl pyrophosphate synthetase (UPPS)

Gene Start:
975004

Gene Stop:
974276

Gene Length:
729

Molecular Weight*:
27381

pI*:
9.60

Net Charge*:
4.64

EC:
2.5.1.31  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table

Secondary Evidence:
Apfel,C.M., Takacs,B., Fountoulakis,M., Stieger,M. and Keck,W.
Use of genomics to identify bacterial undecaprenyl pyrophosphate synthetase: cloning, expression, and characterization of the essential uppS gene.
J. Bacteriol. 181(2): 483-492,1999.
Medline: 99102211.

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to undecaprenyl pyrophosphate synthetase from H. influenzae (1175330), E. coli (6175088), Neisseria meningitidis (7225405), among others. Also hits to hypothetical proteins from E. coli (1552751), Zymomonas mobilis (4768864), among others.

HD1196 is similar to hypothetical proteins from C. trachomatis (CT450), C. pneumoniae (CPn0566), and T. pallidum (TP0603). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.



COGS Summary:  COGS Search
BeTs to 16 clades of COG0020
COG name: Undecaprenyl pyrophosphate synthase
Functional Class: I
The phylogenetic pattern of COG0020 is AmtkYqvcebRhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001441 (Undecaprenyl pyrophosphate synthetase family) with a combined E-value of 9.6e-82.
    IPB001441A    13-27
    IPB001441B    56-83
    IPB001441C    126-153
    IPB001441D    182-219


ProDom Summary:  Protein Domain Search
Residues 19-240 are 72% similar to a (UNDECAPRENYL SYNTHETASE CELL) protein domain (PD003461) which is seen in Q9CJL4_PASMU.



Paralogs:  Local Blast Search
HD1196 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 19 to 240 (E-value = 2.9e-128) place HD1196 in the UPP_synthetase family which is described as Putative undecaprenyl diphosphate synthase (PF01255)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VETSVNFDPSNMPQHVAIIMDGNGRWAKKQGKLRVFGHQNGVNAVRAAVH
FAAKYGIKVLTLYAFSSENWNRPATEVSALMSLFIQALNTEVSKLHKHNI
RLNILGDKTRFSDSLQKRIIESETLTAHNTRLTLNIAANYGSHWDITEAT
KKLAEKVKLGKISVTDITPEKVQRALVTAEQPPVDLLIRTSGEQRISNFL
LWQIAYAELFFSDVLWPDFDETSFSEAIYAYQQRERRFGGCE$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAAACTTCTGTGAATTTTGATCCTTCAAATATGCCTCAACACGTTGC
AATCATTATGGATGGTAATGGGCGTTGGGCAAAAAAACAAGGTAAGTTAC
GTGTTTTTGGTCACCAAAATGGTGTTAATGCTGTTCGTGCTGCTGTACAC
TTTGCGGCTAAATACGGTATAAAAGTACTTACATTGTATGCCTTTAGCAG
TGAAAACTGGAACCGCCCCGCTACAGAAGTATCCGCATTAATGTCGCTTT
TTATACAGGCATTAAATACTGAAGTGAGTAAACTACACAAACATAATATC
CGCTTAAATATTTTAGGCGATAAAACTCGATTTAGTGATAGTTTACAAAA
ACGTATCATTGAATCGGAAACGTTAACTGCTCACAATACAAGGCTAACAC
TTAATATTGCGGCTAATTATGGTAGTCACTGGGATATCACAGAAGCAACA
AAAAAACTCGCAGAAAAAGTCAAATTAGGTAAAATATCCGTGACAGATAT
TACCCCTGAAAAAGTTCAACGTGCATTAGTAACCGCTGAACAACCACCTG
TCGATTTACTCATTAGAACAAGTGGTGAACAACGCATCAGCAATTTTTTA
CTTTGGCAAATTGCCTATGCAGAACTATTTTTTAGCGATGTATTATGGCC
TGATTTTGATGAAACAAGCTTCAGCGAAGCTATTTACGCTTATCAACAAA
GAGAACGCCGTTTTGGTGGCTGTGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy