Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR873 IGR874 IGR879 IGR872 IGR876 IGR877 IGR871 IGR878 IGR875 HD1200 gloB, - HD1197 pgpB, - HD1199 uppS, - HD1196 skp,omp26, - HD1190 cdsA, - HD1193 waaQ, - HD1202 ecfE,yaeL, - HD1192 D15, - HD1191 lgtF, - HD1201 HD1200 gloB, - HD1197 pgpB, - HD1199 uppS, - HD1196 skp,omp26, - HD1190 cdsA, - HD1193 waaQ, - HD1202 ecfE,yaeL, - HD1192 D15, - HD1191 lgtF, - HD1201 HD1200 gloB, - HD1197 pgpB, - HD1199 uppS, - HD1196 skp,omp26, - HD1190 cdsA, - HD1193 waaQ, - HD1202 ecfE,yaeL, - HD1192 D15, - HD1191 lgtF, - HD1201
* Calculated from Protein Sequence

Gene ID: HD1193

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
cdsA  

Definition:
CDP diglyceride synthetase

Gene Start:
974259

Gene Stop:
973390

Gene Length:
870

Molecular Weight*:
31984

pI*:
10.20

Net Charge*:
11.13

EC:
2.7.7.41  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Secondary Evidence:
Icho,T., Sparrow,C.P. and Raetz,C.R.
Molecular cloning and sequencing of the gene for CDP-diglyceride synthetase of Escherichia coli.
J. Biol. Chem. 260(22): 12078-12083, 1985.
Medline: 86008268.

Nampoothiri KM, Hoischen C, Bathe B, Mockel B, Pfefferle W, Krumbach K, Sahm H, Eggeling L.
Expression of genes of lipid synthesis and altered lipid composition modulates L-glutamate efflux of Corynebacterium glutamicum.
Appl Microbiol Biotechnol. 2002 Jan;58(1):89-96.
PMID: 11831479

Comment:
0

Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to phosphatidate cytidylytransferase from H. influenzae (1168876, 2231184), E. coli (116056), Pseudomonas aeruginosa (2498227), among others.

HD1193 is similar to phosphatidate cytidylytransferase from U. urealyticum (UU511), C. pneumoniae (CPn0567), C. trachomatis (CT451), M. pneumoniae (MP0205), M. genitalium (MG437, probable), and T. pallidum (TP0602).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0575
COG name: CDP-diglyceride synthetase
Functional Class:  I
The phylogenetic pattern of COG0575 is amtkyqvcEbrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000374 (Phosphatidate cytidylyltransferase) with a combined E-value of 2.1e-28.
    IPB000374A    186-198
    IPB000374B    246-273


ProDom Summary:  Protein Domain Search
Residues 190-289 are 58% similar to a (CYTIDYLYLTRANSFERASE COMPLETE PROTEOME) protein domain (PD016601) which is seen in CDSA_HAEIN.

Residues 189-286 are 48% similar to a (CYTIDYLYLTRANSFERASE SYNTHASE CDP-DIGLYCERIDE SYNTHETASE) protein domain (PD334873) which is seen in Q9KPV7_VIBCH.

Residues 41-188 are 44% similar to a (CYTIDYLYLTRANSFERASE PHOSPHATIDATE) protein domain (PD167880) which is seen in Q9CJL3_PASMU.



Paralogs:  Local Blast Search

HD1193 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 288 (E-value = 1.7e-78) place HD1193 in the CTP_transf_1 family which is described as Cytidylyltransferase family (PF01148)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLKERILSAIAMIIAVLAGIFLLSPLPFTLILAAVITAAIWEWAQFAGFK
RSLSRAIITFVTICLFILLIFANTHYIRAGRFLTDQTIPLLFISCCWWLI
AFGLVISYPKSASLWSKSITAKFIFGFCTLIPFFIAILALRFNNYAFNQF
QGAYLLLYVCLLVWCADSGAYFFGRAFGKRKLAAKVSPSKSWEGALGGLI
TSCVMALLFIKLTPNNIFGREFETLPFIIVSVATVAVSSLGDLAESMFKR
QANIKDSSNLIPGHGGILDRIDSLTAAIPFFATLFFFVL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTAAAGAACGCATACTTTCTGCTATAGCAATGATTATCGCCGTATT
AGCAGGCATTTTTTTACTTTCTCCACTCCCATTCACATTAATTTTAGCAG
CAGTTATTACCGCTGCAATCTGGGAATGGGCCCAATTTGCAGGCTTTAAG
CGGTCACTTTCTCGCGCAATTATCACCTTTGTGACAATATGCTTATTTAT
TCTGCTGATTTTTGCTAATACTCATTATATCCGCGCCGGTCGTTTTTTAA
CGGATCAAACGATTCCTTTATTATTCATTTCTTGTTGTTGGTGGCTAATC
GCATTTGGCTTAGTGATCAGTTATCCAAAATCAGCTAGCCTTTGGTCTAA
ATCTATTACAGCAAAATTTATTTTTGGCTTCTGCACGTTAATCCCATTTT
TTATTGCAATACTTGCATTACGATTCAACAACTACGCCTTCAATCAATTT
CAAGGCGCGTATTTATTACTTTATGTATGCCTATTAGTATGGTGTGCTGA
TTCTGGTGCTTATTTCTTCGGCAGAGCATTTGGAAAGCGAAAATTAGCCG
CTAAAGTATCACCCAGTAAGTCTTGGGAGGGCGCATTGGGAGGCTTAATC
ACTTCTTGCGTGATGGCTTTATTATTCATAAAACTAACGCCAAATAATAT
TTTTGGTCGCGAATTTGAAACACTCCCCTTTATTATAGTCTCGGTTGCTA
CAGTCGCCGTTTCAAGTTTAGGTGATTTAGCAGAAAGTATGTTCAAACGG
CAAGCTAACATAAAAGACAGTAGTAATTTAATTCCCGGCCATGGCGGTAT
TTTAGATCGCATTGATAGTTTAACTGCAGCCATTCCATTTTTTGCTACCT
TATTCTTTTTTGTATTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy