Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR873 IGR874 IGR872 IGR876 IGR870 IGR877 IGR871 IGR878 IGR875 HD1200 gloB, - HD1197 uppS, - HD1196 pgpB, - HD1199 skp,omp26, - HD1190 cdsA, - HD1193 firA,lpxD, - HD1189 ecfE,yaeL, - HD1192 D15, - HD1191 lgtF, - HD1201 HD1200 gloB, - HD1197 uppS, - HD1196 pgpB, - HD1199 skp,omp26, - HD1190 cdsA, - HD1193 firA,lpxD, - HD1189 ecfE,yaeL, - HD1192 D15, - HD1191 lgtF, - HD1201 HD1200 gloB, - HD1197 uppS, - HD1196 pgpB, - HD1199 skp,omp26, - HD1190 cdsA, - HD1193 firA,lpxD, - HD1189 ecfE,yaeL, - HD1192 D15, - HD1191 lgtF, - HD1201
* Calculated from Protein Sequence

Gene ID: HD1192

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ecfE  yaeL  

Definition:
transmembrane protein

Gene Start:
973383

Gene Stop:
972070

Gene Length:
1314

Molecular Weight*:
48984

pI*:
9.30

Net Charge*:
5.37

EC:
3.4.24.-  

Functional Class:
Unassigned  

Pathway: pathway table

Secondary Evidence:
Dartigalongue,C., Loferer,H. and Raina,S.
EcfE, a new essential inner membrane protease: its role in the
regulation of heat shock response in Escherichia coli
EMBO J. 20 (21), 5908-5918 (2001)
MEDLINE: 21547928

Comment:


Blast Summary:  PSI-Blast Search
Many significnt hits to membrane proteins from H. influenzae (gi16272855), Salmonella Typhi (gi16759213),Yersinia pestis (gi16121351), among others. Many significant hits to membrane related protease and Zn metalloprotease from Pasteurell multocida (gi20978841), H. influenzae (gi1175509), Salmonella Typhi (gi20978462), Salmonella typhimurium LT2 (gi16763613, gi20978466), Y. pestis (gi20978463), and E. coli (gi26246122), among others.

Several significant hits using gapped BLAST to hypothetical proteins from H. influenzae (2231185, 1175509), E. coli (1723192), Neisseria meningitidis (722540), among others.

HD1192 is similar to conserved hypothetical proteins from T. pallidum (TP0600, possible zinc protease) and C. trachomatis (CT072, possible integral membrane protein). Also similar to metalloprotease from C. pneumoniae (CPn0344). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
BeTs to 14 clades of COG0750
COG name: Predicted membrane-associated Zn-dependent proteases 1
Functional Class: M
The phylogenetic pattern of COG0750 is AmtK-qvCebrhUj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 6-95 are 64% similar to a (COMPLETE PROTEOME PROTEASE) protein domain (PD004820) which is seen in Q9CJL2_PASMU.

Residues 345-426 are 57% similar to a (COMPLETE PROTEOME PROTEASE TRANSMEMBRANE) protein domain (PD005718) which is seen in YAEL_ECOLI.

Residues 98-163 are 43% similar to a (PROTEOME COMPLETE PROTEASE TRANSMEMBRANE) protein domain (PD015674) which is seen in YAEL_HAEIN.

Residues 283-344 are 51% similar to a (PROTEOME COMPLETE TRANSMEMBRANE VC2253) protein domain (PD021859) which is seen in Q9CJL2_PASMU.

Residues 363-435 are 41% similar to a (COMPLETE PROTEOME LPXA FABZ) protein domain (PD395252) which is seen in O67776_AQUAE.



Paralogs:  Local Blast Search
HD1192 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 433 (E-value = 7.3e-53) place HD1192 in the Peptidase_M50 family which is described as Peptidase family M50 (PF02163)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTAILAFLILICVLVFVHEYGHFWAARRCGVKVLRFSIGFGKVLFQKVDK
QGTEFVFSLIPLGGYVQMWEGNESINTDKTQSLMQKSRLQRAFIIIAGPM
ANLLFAVLAYFVVFSYGMPTLKPVIAEVTPNSIAAAAKLPTEFEIKQVDD
KQVQDWDEVTLTLVSLIGSKDIKIEGSLIDESRMQSFYLDLSAWHIDSTK
ENPLKTLGIQTKKATIKPEIKQIIDDSPANNVGLKAGDLILTINKQPFDW
YYLITEVKTGRPIHLLVQRGNEQKQLLIQPEKKDDRYIIGIVPHYEPLTD
KYRTELKYDMLTALQKSIEKVTALIKTILKFIANLITGDLSLKNMSGPIS
MAKGAGTTAEIGWIYYLSFMALISVNLGIMNLFPILPLDGGQLVLIATEA
IKGKPISTNFQLRFQQLGAVFVLALMIFTLLNDVIHF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGCTATTCTTGCATTCTTAATTTTAATTTGTGTACTGGTTTTTGT
ACACGAATATGGTCATTTTTGGGCAGCACGTCGTTGTGGTGTAAAAGTCC
TTCGCTTCTCGATTGGCTTTGGTAAAGTTCTATTTCAAAAGGTAGATAAA
CAAGGGACTGAGTTTGTTTTTTCCTTAATTCCACTTGGTGGCTATGTACA
AATGTGGGAAGGTAATGAATCCATTAACACGGATAAAACACAATCCCTAA
TGCAAAAATCCCGTTTACAAAGAGCATTTATTATCATAGCCGGGCCTATG
GCTAACCTATTATTTGCTGTTTTGGCTTATTTTGTAGTGTTTAGTTATGG
TATGCCGACACTCAAACCCGTCATAGCTGAAGTCACGCCAAATAGTATTG
CCGCCGCCGCTAAATTACCGACAGAATTTGAAATAAAACAAGTTGATGAT
AAACAAGTTCAAGATTGGGATGAAGTCACGCTTACCTTAGTTAGCTTAAT
TGGCTCCAAAGATATTAAAATTGAAGGTTCATTAATAGATGAAAGTCGAA
TGCAATCTTTTTATCTCGATCTTTCCGCTTGGCATATCGACAGCACTAAA
GAAAATCCATTAAAAACCTTGGGTATTCAAACTAAAAAAGCAACGATAAA
ACCAGAAATAAAACAAATCATTGATGATTCGCCAGCAAATAACGTTGGTT
TAAAAGCTGGCGATCTAATTTTAACTATTAATAAACAACCATTTGATTGG
TATTATCTTATAACAGAAGTTAAAACAGGTCGTCCAATTCATTTATTAGT
TCAACGTGGCAATGAACAAAAGCAATTGTTAATTCAACCGGAAAAAAAAG
ACGACCGCTATATAATCGGCATTGTGCCACACTATGAACCGCTCACAGAT
AAGTATCGAACAGAATTAAAGTATGATATGCTTACTGCATTACAAAAAAG
CATTGAAAAAGTAACCGCTTTAATTAAAACCATACTTAAATTTATCGCTA
ATTTAATCACGGGTGACCTCTCATTAAAAAATATGAGCGGTCCTATTTCT
ATGGCAAAAGGTGCGGGTACAACTGCAGAAATTGGCTGGATATATTATCT
AAGCTTTATGGCGCTGATCAGTGTCAATTTAGGTATAATGAATTTATTTC
CAATTCTACCGCTAGATGGTGGCCAATTAGTCTTGATTGCTACAGAAGCC
ATAAAAGGTAAACCTATATCAACAAATTTTCAATTACGTTTTCAACAATT
AGGTGCTGTATTTGTATTGGCTTTAATGATCTTTACCTTACTTAATGACG
TTATTCATTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy