Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR869 IGR872 IGR870 IGR868 IGR867 IGR871 fabZ, - HD1188 skp,omp26, - HD1190 lpxA, - HD1187 firA,lpxD, - HD1189 ecfE,yaeL, - HD1192 D15, - HD1191 dxr, - HD1186 ppG,relA, - HD1185 fabZ, - HD1188 skp,omp26, - HD1190 lpxA, - HD1187 firA,lpxD, - HD1189 ecfE,yaeL, - HD1192 D15, - HD1191 dxr, - HD1186 ppG,relA, - HD1185 fabZ, - HD1188 skp,omp26, - HD1190 lpxA, - HD1187 firA,lpxD, - HD1189 ecfE,yaeL, - HD1192 D15, - HD1191 dxr, - HD1186 ppG,relA, - HD1185
* Calculated from Protein Sequence

Gene ID: HD1189

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
firA  lpxD  

Definition:
UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acetyltransferase

Gene Start:
968759

Gene Stop:
967734

Gene Length:
1026

Molecular Weight*:
36039

pI*:
6.00

Net Charge*:
-3.93

EC:
2.3.1.-  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Aminosugars metabolism
Butanoate metabolism
D-Arginine and D-ornithine metabolism
Glycerolipid metabolism
Histidine metabolism
Lipopolysaccharide biosynthesis
Lysine biosynthesis
Lysine degradation
Phenylalanine metabolism
Tyrosine metabolism
Valine, leucine and isoleucine degradation

Secondary Evidence:
Dicker,I.B. and Seetharam,S.
Cloning and nucleotide sequence of the firA gene and the
firA200(Ts) allele from Escherichia coli
J. Bacteriol. 173 (1), 334-344 (1991)
M:91100302

Dicker,I.B. and Seetharam,S.
What is known about the structure and function of the Escherichia
coli protein FirA?
Mol. Microbiol. 6 (7), 817-823 (1992)
MEDLINE: 92292946

Vuorio,R. and Vaara,M.
Mutants carrying conditionally lethal mutations in outer membrane
genes omsA and firA (ssc) are phenotypically similar, and omsA is
allelic to firA
J. Bacteriol. 174 (22), 7090-7097 (1992)
MEDLINE: 93054317

Helander,I.M., Lindner,B., Seydel,U. and Vaara,M.
Defective biosynthesis of the lipid A component of
temperature-sensitive firA (omsA) mutant of Escherichia coli
Eur. J. Biochem. 212 (2), 363-369 (1993)
MEDLINE: 93185653

Kelly,T.M., Stachula,S.A., Raetz,C.R. and Anderson,M.S.
The firA gene of Escherichia coli encodes
UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase. The
third step of endotoxin biosynthesis
J. Biol. Chem. 268 (26), 19866-19874 (1993)
MEDLINE: 93374989


Comment:
For other "lpx" genes, see HD1187 (lpxA), HD0816 (lpxC), HD0846 (lpxB).

Blast Summary:  PSI-Blast Search
Significant hits using gapped BLAST to UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase from Pasteurella multocida (628857), H. influenzae (1170829), Salmonella typhimurium (120185), E. coli (120183), among others.

HD1189 is similar to UDP glucosamine N-acyltransferase from C. pneumoniae (CPn0302, CPn0650) and C. trachomatis (CT243, CT531).
No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1044
COG name: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
Functional Class:  M
The phylogenetic pattern of COG1044 is -----q-ce--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001451 (Bacterial transferase hexapeptide repeat) with a combined E-value of 1.7e-09.
    IPB001451    114-149
    IPB001451    263-298
    IPB001451    102-137
    IPB001451    227-262
    IPB001451    120-155
    IPB001451    126-161
    IPB001451    132-167
    IPB001451    138-173
    IPB001451    144-179
    IPB001451    245-280
    IPB001451    108-143
    IPB001451    221-256
    IPB001451    96-131
    IPB001451    233-268
    IPB001451    239-274
    IPB001451    251-286
    IPB001451    150-185


ProDom Summary:  Protein Domain Search
Residues 156-204 are 81% similar to a (N-ACYLTRANSFERASE GLUCOSAMINE) protein domain (PD336018) which is seen in LPXD_HAEIN.

Residues 240-289 are 80% similar to a (N-ACYLTRANSFERASE GLUCOSAMINE LIPID) protein domain (PD004893) which is seen in LPXD_HAEIN.

Residues 205-239 are 82% similar to a (RESISTANCE PROTEOME) protein domain (PD405277) which is seen in Q9KPW2_VIBCH.

Residues 4-100 are 58% similar to a (LIPID N-ACYLTRANSFERASE GLUCOSAMINE) protein domain (PD289333) which is seen in Q9CJL0_PASMU.

Residues 290-338 are 77% similar to a (N-ACYLTRANSFERASE LIPID COMPLETE) protein domain (PD378940) which is seen in Q9CJL0_PASMU.

Residues 205-289 are 79% similar to a (COMPLETE PROTEOME TRANSFERASE ACYLTRANSFERASE LIPID) protein domain (PD000343) which is seen in LPXD_ECOLI.



Paralogs:  Local Blast Search


HD1189 is paralogously related to HD1187 (6e-13), HD1511 (6e-07) and HD0630 (0.001).


Pfam Summary:  Pfam Search
Residues 4 to 104 (E-value = 4.1e-42) place HD1189 in the LpxD family which is described as UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD (PF04613)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MAVFRLSELAEQIGATLKGNADLAITSIAALNNAEPTHITFISNAKYRSQ
LSQSKAGAIIVTAEDVEFCQATQNLLIVKDPYLAYALLAQYMDDLPKSAN
EISESAVISATAKLGKNVSIGANVVIESGVELADDITIGAGCFIGKNTKI
GARSHLWANISVYHNVEIGSDCLIQSSAVIGSDGFGYANDKGRWIKIPQT
GGVIIGNRVEIGACTCIDRGALDPTIIEDNVIIDNLCQIAHNVHIGFGTA
IAGGVILAGSLKIGRFCQIGGASVINGHMEICDGAIITGMSMIMKPITEK
GVYSSGIPAQTNKEWRKTAALTMNIADMNKRLKAIEKQLTE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTGTTTTCCGTTTAAGTGAACTTGCGGAACAAATCGGCGCTACCCT
AAAAGGTAACGCCGATTTGGCTATTACTAGTATTGCCGCATTAAATAATG
CTGAACCAACGCACATCACATTTATCTCAAACGCAAAATATCGTTCCCAA
CTCTCACAATCTAAAGCAGGAGCCATTATTGTTACTGCTGAAGATGTTGA
ATTTTGCCAAGCAACACAAAACCTACTGATTGTAAAAGATCCATATTTAG
CCTATGCATTACTGGCACAATATATGGACGATCTCCCAAAATCTGCTAAT
GAAATATCTGAAAGTGCTGTCATTTCAGCCACCGCCAAATTAGGTAAGAA
TGTTTCTATCGGGGCTAATGTGGTCATAGAAAGTGGCGTTGAGCTAGCAG
ACGATATCACCATTGGAGCGGGTTGTTTTATCGGCAAAAATACTAAAATT
GGTGCAAGAAGCCACCTGTGGGCAAATATCTCTGTCTACCATAATGTAGA
AATCGGCAGCGATTGCTTAATTCAATCATCTGCAGTAATTGGCAGTGATG
GATTTGGTTATGCAAATGATAAAGGACGCTGGATTAAAATTCCTCAAACT
GGAGGCGTTATCATTGGTAACCGTGTTGAAATTGGCGCCTGTACTTGTAT
CGATCGCGGTGCACTGGATCCAACCATTATTGAAGATAATGTAATTATCG
ACAATTTATGCCAAATTGCCCATAATGTACATATTGGCTTTGGCACAGCC
ATTGCTGGTGGTGTAATTCTAGCGGGCAGCCTAAAAATTGGTCGATTCTG
TCAAATTGGTGGGGCTAGCGTGATCAATGGACATATGGAAATTTGTGATG
GAGCAATCATCACTGGTATGAGTATGATTATGAAACCCATTACTGAAAAA
GGGGTTTATTCATCCGGTATTCCCGCACAAACCAATAAAGAATGGCGTAA
AACAGCGGCGCTAACGATGAATATAGCAGATATGAATAAGCGTCTTAAAG
CAATTGAAAAGCAGTTAACTGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy